DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or83a and Or33a

DIOPT Version :9

Sequence 1:NP_524234.2 Gene:Or83a / 40648 FlyBaseID:FBgn0037322 Length:453 Species:Drosophila melanogaster
Sequence 2:NP_523553.1 Gene:Or33a / 34601 FlyBaseID:FBgn0026392 Length:378 Species:Drosophila melanogaster


Alignment Length:428 Identity:86/428 - (20%)
Similarity:151/428 - (35%) Gaps:99/428 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 YPFGYYVNGSGVLAVLVRFCDLTYELF-NYFVSVH-IAGLY---ICTIYINYGQGDLDFFVNCLI 92
            |||.             |..|.|...| .....|| |.|:|   ...::     ..|.|...||.
  Fly    29 YPFR-------------RLVDFTITSFITILFPVHLILGMYKKPQIQVF-----RSLHFTSECLF 75

  Fly    93 ---QTIIYLWTIAMKLYFRRFRPGLLNTILSNINDEYETRSAVGFSFVTMAGSYRMSKLWIKTYV 154
               :...:.|    ||...:...|||..:.|.:..|.|.      ::.....| |::::..|:|:
  Fly    76 CSYKFFCFRW----KLKEIKTIEGLLQDLDSRVESEEER------NYFNQNPS-RVARMLSKSYL 129

  Fly   155 YCCYIGTIFWLALPIAYRDRSLPLACWYPFDY-TQPGVYEVVFLLQAMG-QIQVAASFASSSGLH 217
            .......|......:....|:|....|:|:|: ....:|.:.|..||:| .:.:..:.|:.|...
  Fly   130 VAAISAIITATVAGLFSTGRNLMYLGWFPYDFQATAAIYWISFSYQAIGSSLLILENLANDSYPP 194

  Fly   218 MVLCVLISGQYDVLFCSLKNVLASSYVLMGANMTELNQLQAEQSAADVEPGQYAYSVEEETPLQE 282
            :..|| :||...:|                                                :..
  Fly   195 ITFCV-VSGHVRLL------------------------------------------------IMR 210

  Fly   283 LLKVGSSMDFSSAFRL-SFVRCIQHHRYIVAALKKIESFYSPIWFVKIGEVTFLM----CLVAFV 342
            |.::|..:..||:... ..:..||.||.:   :|.|....|.:...::|:  ||.    ..:..:
  Fly   211 LSRIGHDVKLSSSENTRKLIEGIQDHRKL---MKIIRLLRSTLHLSQLGQ--FLSSGINISITLI 270

  Fly   343 STKSTAANSFMRMVSLGQYLLLVLYELFIICYFADIVFQNSQRCGEALWRSPWQRHLKDVRSDYM 407
            :....|.|:| .|:....:...:|.|||..||:..::.....:...|::.|.|.:..|......:
  Fly   271 NILFFAENNF-AMLYYAVFFAAMLIELFPSCYYGILMTMEFDKLPYAIFSSNWLKMDKRYNRSLI 334

  Fly   408 FFMLNSRRQFQLTAGKISNLNVDRFRGTITTAFSFLTL 445
            ..|..:.....:.||.|..:::..|..|:..|:||.||
  Fly   335 ILMQLTLVPVNIKAGGIVGIDMSAFFATVRMAYSFYTL 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or83aNP_524234.2 7tm_6 <155..440 CDD:251636 52/291 (18%)
Or33aNP_523553.1 7tm_6 61..367 CDD:251636 69/376 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.