DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment usf1l and Mitf

DIOPT Version :9

Sequence 1:NP_998359.1 Gene:usf1l / 406475 ZFINID:ZDB-GENE-040426-2269 Length:283 Species:Danio rerio
Sequence 2:NP_001245436.1 Gene:Mitf / 3885647 FlyBaseID:FBgn0263112 Length:837 Species:Drosophila melanogaster


Alignment Length:186 Identity:42/186 - (22%)
Similarity:74/186 - (39%) Gaps:41/186 - (22%)


- Green bases have known domain annotations that are detailed below.


Zfish   118 LSDTTAGAMVTGLQTADSVLSQPTSA-----------------------GQLYVMMSPQDVLATT 159
            :|.|::....|....:.||.|..||.                       .:|.:...||::    
  Fly   434 ISSTSSSLQSTSAPISPSVSSVATSVSEPDDIFDDILQNDSFNFDKNFNSELSIKQEPQNL---- 494

Zfish   160 QPSKPGSQRVSRDDKRRAQHNEVERRRRDKINQWIVQLSKTIP---DCTYDAKNN--QSKSGILS 219
              :......:::|.:::..||.:|||||..||..|.:|...:|   |..|:...:  .:|..||.
  Fly   495 --TDAEMNALAKDRQKKDNHNMIERRRRFNINDRIKELGTLLPKGSDAFYEVVRDIRPNKGTILK 557

Zfish   220 KACDYIQELRQSNARLEDELNTADRLRMDNQLLRKEMEEWKSKNQMIRNQLRQHGI 275
            .:.|||:.|:....||........::.:.|:.|...::|       :..|.:.|||
  Fly   558 SSVDYIKCLKHEVTRLRQNELRQRQVELQNRKLMSRIKE-------LEMQAKSHGI 606

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
usf1lNP_998359.1 HLH 175..229 CDD:278439 20/58 (34%)
MitfNP_001245436.1 MITF_TFEB_C_3_N <272..>311 CDD:292573
HLH 505..570 CDD:238036 22/64 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1318
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1708
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.