DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1172 and AT1G53400

DIOPT Version :9

Sequence 1:NP_001246931.1 Gene:CG1172 / 40647 FlyBaseID:FBgn0264712 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_564630.1 Gene:AT1G53400 / 841776 AraportID:AT1G53400 Length:114 Species:Arabidopsis thaliana


Alignment Length:130 Identity:58/130 - (44%)
Similarity:75/130 - (57%) Gaps:22/130 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 TMSVSSASISRPASAGIAMGAARKNRPLCHETIRWRSDVPLTEGQLRSKRDEFWDTAPAFDGRKE 78
            |.|.:..|:.:          .||.:|       |:...|:|:.:|...|:|||||||.:.||||
plant     7 TQSQADGSVKK----------IRKPKP-------WKHTQPITKAELMKLREEFWDTAPHYGGRKE 54

  Fly    79 IWDALRAATTAAEGLDFQMAQAILDGANVSVPNGYLTECYDELGTQYKVPIYCLSYPINIVKEEN 143
            ||||||||..|    |..:||||:|.|.|.|.|..||.||||.|.:|::|.|.||.|.|: :|||
plant    55 IWDALRAAAEA----DISLAQAIVDSAGVIVQNTDLTVCYDERGAKYELPKYVLSEPTNL-EEEN 114

  Fly   144  143
            plant   115  114

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1172NP_001246931.1 UBD 37..141 CDD:293064 51/103 (50%)
UBQ 161..232 CDD:214563
DC_UbP_C 164..233 CDD:176389
AT1G53400NP_564630.1 UBD 16..113 CDD:406775 52/118 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 101 1.000 Domainoid score I2324
eggNOG 1 0.900 - - E1_KOG0013
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H15484
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1221075at2759
OrthoFinder 1 1.000 - - FOG0001843
OrthoInspector 1 1.000 - - otm2644
orthoMCL 1 0.900 - - OOG6_103755
Panther 1 1.100 - - O PTHR13609
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1367
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1110.820

Return to query results.
Submit another query.