DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1172 and AT1G16960

DIOPT Version :9

Sequence 1:NP_001246931.1 Gene:CG1172 / 40647 FlyBaseID:FBgn0264712 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_173140.1 Gene:AT1G16960 / 838267 AraportID:AT1G16960 Length:114 Species:Arabidopsis thaliana


Alignment Length:115 Identity:53/115 - (46%)
Similarity:69/115 - (60%) Gaps:9/115 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 ASAGIAMGAARK-NRPLCHETIRWRSDVPLTEGQLRSKRDEFWDTAPAFDGRKEIWDALRAATTA 89
            :|..||.|...| .||.     .|:...|::..:|...|:|||||||.:.|:|||||||||   |
plant     5 SSRTIAEGKKEKIRRPK-----TWKHPQPISRDELTQMREEFWDTAPHYGGKKEIWDALRA---A 61

  Fly    90 AEGLDFQMAQAILDGANVSVPNGYLTECYDELGTQYKVPIYCLSYPINIV 139
            ||..|..:||.||:.|.|.|.|..||.||||.|::|::|.|.|..|.|::
plant    62 AEEDDLSLAQTILESAGVIVQNTDLTICYDEKGSKYELPKYVLRDPSNLI 111

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1172NP_001246931.1 UBD 37..141 CDD:293064 49/104 (47%)
UBQ 161..232 CDD:214563
DC_UbP_C 164..233 CDD:176389
AT1G16960NP_173140.1 UBD 13..112 CDD:374553 49/107 (46%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 101 1.000 Domainoid score I2324
eggNOG 1 0.900 - - E1_KOG0013
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1221075at2759
OrthoFinder 1 1.000 - - FOG0001843
OrthoInspector 1 1.000 - - otm2644
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13609
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1367
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.920

Return to query results.
Submit another query.