DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1172 and UBTD1

DIOPT Version :9

Sequence 1:NP_001246931.1 Gene:CG1172 / 40647 FlyBaseID:FBgn0264712 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_079230.1 Gene:UBTD1 / 80019 HGNCID:25683 Length:227 Species:Homo sapiens


Alignment Length:233 Identity:116/233 - (49%)
Similarity:155/233 - (66%) Gaps:13/233 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGACVCRMNPDNETMSVSSASISRPASAGIAMGAARKNRPLCHETIRWRSDVPLTEGQLRSKRDE 65
            ||.||.|...:            |||:.|.....|.:|.||..|.::|:||.|:|:|||||||||
Human     1 MGNCVGRQRRE------------RPAAPGHPRKRAGRNEPLKKERLKWKSDYPMTDGQLRSKRDE 53

  Fly    66 FWDTAPAFDGRKEIWDALRAATTAAEGLDFQMAQAILDGANVSVPNGYLTECYDELGTQYKVPIY 130
            ||||||||:|||||||||:||..|||..|.::||||||||::::|:|.|.|||||||.:|::|||
Human    54 FWDTAPAFEGRKEIWDALKAAAYAAEANDHELAQAILDGASITLPHGTLCECYDELGNRYQLPIY 118

  Fly   131 CLSYPINIVKEENGRDSPAEYSEPVDGGTDIFLKLRISSTMTDVKLPVYSKDTVGQCKKKLQAAE 195
            |||.|:|::.|....:|......|.....:..||:|: ||..||:|.....|||||.|::|.|.|
Human   119 CLSPPVNLLLEHTEEESLEPPEPPPSVRREFPLKVRL-STGKDVRLSASLPDTVGQLKRQLHAQE 182

  Fly   196 GVDACCQRWFYSGKLLGDKVPIDECSIHQGYVVQVIVN 233
            |::...||||:|||||.|:..:.|..|.:.:|:|||:|
Human   183 GIEPSWQRWFFSGKLLTDRTRLQETKIQKDFVIQVIIN 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1172NP_001246931.1 UBD 37..141 CDD:293064 68/103 (66%)
UBQ 161..232 CDD:214563 33/70 (47%)
DC_UbP_C 164..233 CDD:176389 33/68 (49%)
UBTD1NP_079230.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..35 14/45 (31%)
UBD 27..126 CDD:406775 66/98 (67%)
Ubl_UBTD1 151..219 CDD:340640 33/68 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154113
Domainoid 1 1.000 157 1.000 Domainoid score I4158
eggNOG 1 0.900 - - E1_KOG0013
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 227 1.000 Inparanoid score I3485
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG58717
OrthoDB 1 1.010 - - D1221075at2759
OrthoFinder 1 1.000 - - FOG0001843
OrthoInspector 1 1.000 - - otm40803
orthoMCL 1 0.900 - - OOG6_103755
Panther 1 1.100 - - LDO PTHR13609
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5544
SonicParanoid 1 1.000 - - X1367
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.