DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1172 and ubtd1b

DIOPT Version :9

Sequence 1:NP_001246931.1 Gene:CG1172 / 40647 FlyBaseID:FBgn0264712 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_001025436.1 Gene:ubtd1b / 571832 ZFINID:ZDB-GENE-050913-62 Length:227 Species:Danio rerio


Alignment Length:247 Identity:119/247 - (48%)
Similarity:156/247 - (63%) Gaps:28/247 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGACVCRMNPDNETMSVSSASISRPASAGIAMGAARK----NRPLCHETIRWRSDVPLTEGQLRS 61
            ||.||.|               .|..:.|......||    |.||..:..:|:||.|:|||||||
Zfish     1 MGGCVGR---------------ERAETRGRGSRTQRKRGGRNEPLKKDKPKWKSDYPMTEGQLRS 50

  Fly    62 KRDEFWDTAPAFDGRKEIWDALRAATTAAEGLDFQMAQAILDGANVSVPNGYLTECYDELGTQYK 126
            ||||||||||||:|||||||||:||..|.|..|.::||||:||||:::|:|.|||||||||.:|:
Zfish    51 KRDEFWDTAPAFEGRKEIWDALKAAAVALECSDHELAQAIVDGANITLPHGSLTECYDELGNRYQ 115

  Fly   127 VPIYCLSYPINIV---KEENGRDSPAEYSEPVDGGTDIF-LKLRISSTMTDVKLPVYSKDTVGQC 187
            :|:|||:.|:|::   .||:..|:|    ||.......| ||:|: ||..|::|.....||:|..
Zfish   116 LPVYCLAPPVNLISERSEEDLTDNP----EPQTAQKKEFQLKVRL-STGKDLRLNASMSDTIGLL 175

  Fly   188 KKKLQAAEGVDACCQRWFYSGKLLGDKVPIDECSIHQGYVVQVIVNTEHYNH 239
            ||:|||.|.:|...||||:|||||.||..:.:..|.:.:|:|||||....||
Zfish   176 KKQLQAQEDIDISHQRWFFSGKLLTDKTRLQDTKIQKDFVIQVIVNQPAPNH 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1172NP_001246931.1 UBD 37..141 CDD:293064 67/110 (61%)
UBQ 161..232 CDD:214563 33/71 (46%)
DC_UbP_C 164..233 CDD:176389 32/68 (47%)
ubtd1bNP_001025436.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..45 16/58 (28%)
UBD 26..130 CDD:293064 66/103 (64%)
UBQ 150..220 CDD:214563 33/70 (47%)
UBQ 152..221 CDD:294102 33/69 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589260
Domainoid 1 1.000 157 1.000 Domainoid score I4116
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 226 1.000 Inparanoid score I3468
OMA 1 1.010 - - QHG58717
OrthoDB 1 1.010 - - D1221075at2759
OrthoFinder 1 1.000 - - FOG0001843
OrthoInspector 1 1.000 - - otm25812
orthoMCL 1 0.900 - - OOG6_103755
Panther 1 1.100 - - LDO PTHR13609
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5544
SonicParanoid 1 1.000 - - X1367
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1312.940

Return to query results.
Submit another query.