DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1172 and ubtd1

DIOPT Version :9

Sequence 1:NP_001246931.1 Gene:CG1172 / 40647 FlyBaseID:FBgn0264712 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_001005656.1 Gene:ubtd1 / 448143 XenbaseID:XB-GENE-993611 Length:240 Species:Xenopus tropicalis


Alignment Length:228 Identity:114/228 - (50%)
Similarity:149/228 - (65%) Gaps:26/228 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGACVCRMNPDNETM-SVSSASISRPASAGIAMGAARKNRPLCHETIRWRSDVPLTEGQLRSKRD 64
            ||.||.|  |..|:. |.|.||..:...||       :|.||..|..||:||.|:|:||||||||
 Frog     1 MGGCVGR--PQGESQRSQSRASGQQRKRAG-------RNEPLKKERPRWKSDYPMTDGQLRSKRD 56

  Fly    65 EFWDTAPAFDGRKEIWDALRAATTAAEGLDFQMAQAILDGANVSVPNGYLTECYDELGTQYKVPI 129
            |||||||||:|||||||||:||..|.|..|.::||||:|||::::|:|.||||||||||:|::|:
 Frog    57 EFWDTAPAFEGRKEIWDALKAAAFAVEANDHELAQAIVDGASITLPHGSLTECYDELGTRYQLPV 121

  Fly   130 YCLSYPINIV---KEENGRDSPAEYSEPVDGGTDIF-LKLRISSTMTDVKLPVYSKDTVGQCKKK 190
            |||:.|:|::   .||:|.|:    .||.......| ||:|: ||..||||.....||:||.||:
 Frog   122 YCLAPPVNLIMERSEEDGTDA----LEPAPNTRREFQLKVRL-STGKDVKLNASMVDTIGQLKKQ 181

  Fly   191 LQAAEGVDACCQRWFY-------SGKLLGDKVP 216
            |.|.||::.|.||||:       ..:..||:.|
 Frog   182 LHAVEGIEPCWQRWFFFWEASHRQNEAPGDEDP 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1172NP_001246931.1 UBD 37..141 CDD:293064 67/106 (63%)
UBQ 161..232 CDD:214563 28/64 (44%)
DC_UbP_C 164..233 CDD:176389 26/60 (43%)
ubtd1NP_001005656.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..48 22/55 (40%)
UBD 29..131 CDD:318622 67/101 (66%)
UBQ 155..>197 CDD:320785 23/42 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 156 1.000 Domainoid score I4127
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 234 1.000 Inparanoid score I3323
OMA 1 1.010 - - QHG58717
OrthoDB 1 1.010 - - D1221075at2759
OrthoFinder 1 1.000 - - FOG0001843
OrthoInspector 1 1.000 - - otm47993
Panther 1 1.100 - - LDO PTHR13609
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5544
SonicParanoid 1 1.000 - - X1367
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1111.110

Return to query results.
Submit another query.