DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1172 and ubtd2

DIOPT Version :9

Sequence 1:NP_001246931.1 Gene:CG1172 / 40647 FlyBaseID:FBgn0264712 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_001002718.2 Gene:ubtd2 / 436991 ZFINID:ZDB-GENE-040718-473 Length:244 Species:Danio rerio


Alignment Length:233 Identity:113/233 - (48%)
Similarity:165/233 - (70%) Gaps:10/233 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGACVCRMNPDNETMSVSSASISRPASAGIAMGAARKNRPLCHETIRWRSDVPLTEGQLRSKRDE 65
            ||.||...:..:.:::.:|      ...|:|:|   :|:||..|..:|:||.|:|:|||||||||
Zfish     5 MGGCVGSHHDSSGSLNENS------DGTGVALG---RNQPLKREKPKWKSDYPMTDGQLRSKRDE 60

  Fly    66 FWDTAPAFDGRKEIWDALRAATTAAEGLDFQMAQAILDGANVSVPNGYLTECYDELGTQYKVPIY 130
            ||||||||:|||||||||:||..|.|..|.::||||:|||::::|:|.|||||||||.:|::|:|
Zfish    61 FWDTAPAFEGRKEIWDALKAAAQAFESNDHELAQAIIDGASITLPHGALTECYDELGNRYQLPVY 125

  Fly   131 CLSYPINIVKEENGRDSPAEYSEPVDGGTDIFLKLRISSTMTDVKLPVYSKDTVGQCKKKLQAAE 195
            |||.|:|:::|::..::......|...|.:..|:||: ||..|::|.|.:.|:|.|.|::||..|
Zfish   126 CLSPPVNMIEEKSESETIEVPEAPASEGQECQLRLRL-STGRDLRLAVRTSDSVQQMKRRLQTQE 189

  Fly   196 GVDACCQRWFYSGKLLGDKVPIDECSIHQGYVVQVIVN 233
            ||.|..||||:||:.|.||:.::|..|.:.|||||||:
Zfish   190 GVAATSQRWFFSGRPLTDKMKLEELKISRDYVVQVIVS 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1172NP_001246931.1 UBD 37..141 CDD:293064 66/103 (64%)
UBQ 161..232 CDD:214563 34/70 (49%)
DC_UbP_C 164..233 CDD:176389 34/68 (50%)
ubtd2NP_001002718.2 UBD 32..136 CDD:293064 66/103 (64%)
UBQ 157..227 CDD:214563 35/70 (50%)
UBQ 158..227 CDD:294102 35/69 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589259
Domainoid 1 1.000 157 1.000 Domainoid score I4116
eggNOG 1 0.900 - - E1_KOG0013
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H15484
Inparanoid 1 1.050 226 1.000 Inparanoid score I3468
OMA 1 1.010 - - QHG58717
OrthoDB 1 1.010 - - D1221075at2759
OrthoFinder 1 1.000 - - FOG0001843
OrthoInspector 1 1.000 - - otm25812
orthoMCL 1 0.900 - - OOG6_103755
Panther 1 1.100 - - O PTHR13609
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1367
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1615.770

Return to query results.
Submit another query.