DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1172 and SPAPB2B4.07

DIOPT Version :9

Sequence 1:NP_001246931.1 Gene:CG1172 / 40647 FlyBaseID:FBgn0264712 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_593893.1 Gene:SPAPB2B4.07 / 2543223 PomBaseID:SPAPB2B4.07 Length:239 Species:Schizosaccharomyces pombe


Alignment Length:260 Identity:60/260 - (23%)
Similarity:106/260 - (40%) Gaps:50/260 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGACVCRMNPDNETMSVSSASISRPASAGI-AMGAARKNRPLCHETIRWRSDVPLTEGQLRSKRD 64
            ||.|:    ..|:...|::....:|:.:.| .:.......||            ||:.::..:|:
pombe     1 MGQCL----SGNQVAGVANNGGEQPSGSNILRLPKLYTPNPL------------LTKEEVEVRRN 49

  Fly    65 EFWDTAPAFDGRKEIWDALRAATTAAEGLDFQMAQAILDGANVSVPNGYLTE-CYDELGTQYKVP 128
            |||:|..|:.|.|||||.|....|.....:.:.|..:...|::::|...::: .||..||.|::|
pombe    50 EFWETCWAYGGSKEIWDVLHKVVTLLYEGNAEAATEMALAADLTIPENDISKGVYDSKGTFYEIP 114

  Fly   129 IYCLSYPINIVKEENGRD----------SPAEYSEPVDGGTDIFLKLR---ISSTMTDVKLPVYS 180
            ......|....:.::..|          .|.:..|..|..|.....|:   :.|::..| |..||
pombe   115 KIVARIPRAFAERKDSLDDEDDNMISSNDPTKSPEEHDTTTKSIASLKDAELDSSLETV-LIRYS 178

  Fly   181 KD------------TVGQCKKKLQ--AAEGVDACCQRWFYSGKLLGDKVPIDECSIHQGYVVQVI 231
            ||            .....|.:|:  ..|.|    ||:|:.|::|..|..:.:.....|.::|.:
pombe   179 KDDKDYSIQINPNLPFSHAKSQLEEVGLENV----QRFFFLGRVLQFKKSLSQQGWTSGMIIQAM 239

  Fly   232  231
            pombe   240  239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1172NP_001246931.1 UBD 37..141 CDD:293064 28/104 (27%)
UBQ 161..232 CDD:214563 20/88 (23%)
DC_UbP_C 164..233 CDD:176389 20/85 (24%)
SPAPB2B4.07NP_593893.1 UBD 27..121 CDD:293064 27/105 (26%)
UBQ 180..239 CDD:294102 13/62 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 52 1.000 Domainoid score I3316
eggNOG 1 0.900 - - E1_KOG0013
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 56 1.000 Inparanoid score I2029
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001843
OrthoInspector 1 1.000 - - oto100841
orthoMCL 1 0.900 - - OOG6_103755
Panther 1 1.100 - - LDO PTHR13609
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5544
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
109.890

Return to query results.
Submit another query.