DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1172 and Ubtd1

DIOPT Version :9

Sequence 1:NP_001246931.1 Gene:CG1172 / 40647 FlyBaseID:FBgn0264712 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_663475.1 Gene:Ubtd1 / 226122 MGIID:2385092 Length:227 Species:Mus musculus


Alignment Length:234 Identity:118/234 - (50%)
Similarity:157/234 - (67%) Gaps:15/234 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGACVCRMNPDNETMSVSSASISRPASAGIAMGAARKNRPLCHETIRWRSDVPLTEGQLRSKRDE 65
            ||.||.|...:            |||:.|.....|.:|.||..|.::|:||.|:|:|||||||||
Mouse     1 MGNCVGRQRRE------------RPAAPGHPRKRAGRNEPLKKERLKWKSDYPMTDGQLRSKRDE 53

  Fly    66 FWDTAPAFDGRKEIWDALRAATTAAEGLDFQMAQAILDGANVSVPNGYLTECYDELGTQYKVPIY 130
            ||||||||:|||||||||:||..|||..|.::||||||||::::|:|.|.|||||||.:|::|||
Mouse    54 FWDTAPAFEGRKEIWDALKAAAYAAEANDHELAQAILDGASITLPHGTLCECYDELGNRYQLPIY 118

  Fly   131 CLSYPINIVKEENGRDSPAEYSEPVDGGTDIF-LKLRISSTMTDVKLPVYSKDTVGQCKKKLQAA 194
            |||.|:|::.|....:| .|..||.......| ||:|: ||..||:|.....|||||.|::|.:.
Mouse   119 CLSPPVNLLLEHTEEES-LEPPEPTPSVRREFPLKVRL-STGKDVRLNASLPDTVGQLKRQLHSQ 181

  Fly   195 EGVDACCQRWFYSGKLLGDKVPIDECSIHQGYVVQVIVN 233
            ||::...||||:|||||.|:..:.|..|.:.:|:|||:|
Mouse   182 EGIEPSWQRWFFSGKLLTDRTRLQETKIQKDFVIQVIIN 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1172NP_001246931.1 UBD 37..141 CDD:293064 68/103 (66%)
UBQ 161..232 CDD:214563 33/71 (46%)
DC_UbP_C 164..233 CDD:176389 32/68 (47%)
Ubtd1NP_663475.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..42 17/52 (33%)
UBD 27..126 CDD:406775 66/98 (67%)
Ubl_UBTD1 151..219 CDD:340640 32/68 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167844358
Domainoid 1 1.000 157 1.000 Domainoid score I4157
eggNOG 1 0.900 - - E1_KOG0013
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 224 1.000 Inparanoid score I3502
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG58717
OrthoDB 1 1.010 - - D1221075at2759
OrthoFinder 1 1.000 - - FOG0001843
OrthoInspector 1 1.000 - - otm42878
orthoMCL 1 0.900 - - OOG6_103755
Panther 1 1.100 - - LDO PTHR13609
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5544
SonicParanoid 1 1.000 - - X1367
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1615.800

Return to query results.
Submit another query.