DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment 7B2 and SCG5

DIOPT Version :9

Sequence 1:NP_001014608.1 Gene:7B2 / 40644 FlyBaseID:FBgn0041707 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_001138229.1 Gene:SCG5 / 6447 HGNCID:10816 Length:212 Species:Homo sapiens


Alignment Length:225 Identity:66/225 - (29%)
Similarity:88/225 - (39%) Gaps:68/225 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 AAAGSKDNVDLVSRSEYARLCDGGSDCILQSGSASGAASHPSLRDDEFLQHSSLWGHQFISGGMG 129
            |.|.|....|.||.::..||..|..:   |.|.|.....:|:      .|..:|.|.|.|.||..
Human    24 AFAYSPRTPDRVSEADIQRLLHGVME---QLGIARPRVEYPA------HQAMNLVGPQSIEGGAH 79

  Fly   130 EG----------PN--------RYPTIVKNDAGLPAYCNPPNPCPEGYDMETQGGSCIVDFENTA 176
            ||          ||        ..|.....|.|.|   :||||||.|   :|....|:.:..:||
Human    80 EGLQHLGPFGNIPNIVAELTGDNIPKDFSEDQGYP---DPPNPCPVG---KTADDGCLENTPDTA 138

  Fly   177 IFSREFQAAQDCTCDNEHMFDCSEQDSADVGGDKGDLNSAVEQYIMQMGQENSLNNVNSLAKKAG 241
            .||||||.       ::|:|| .|.|...:|  |.:.....|:  |:.|:.....:|        
Human   139 EFSREFQL-------HQHLFD-PEHDYPGLG--KWNKKLLYEK--MKGGERRKRRSV-------- 183

  Fly   242 YPVMPDPRLDDAVINPFLQGDRLP-IAAKK 270
                          ||:|||.||. :.|||
Human   184 --------------NPYLQGQRLDNVVAKK 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
7B2NP_001014608.1 Secretogranin_V 45..275 CDD:283048 66/225 (29%)
SCG5NP_001138229.1 Secretogranin_V 22..199 CDD:368368 64/223 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 174..212 12/48 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165158696
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4187
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 49 1.000 Inparanoid score I5484
Isobase 1 0.950 - 0 Normalized mean entropy S6844
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1534994at2759
OrthoFinder 1 1.000 - - FOG0007944
OrthoInspector 1 1.000 - - oto89188
orthoMCL 1 0.900 - - OOG6_108923
Panther 1 1.100 - - LDO PTHR12738
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4405
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1312.740

Return to query results.
Submit another query.