DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment 7B2 and scg5

DIOPT Version :9

Sequence 1:NP_001014608.1 Gene:7B2 / 40644 FlyBaseID:FBgn0041707 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_957020.1 Gene:scg5 / 393699 ZFINID:ZDB-GENE-040426-1687 Length:219 Species:Danio rerio


Alignment Length:221 Identity:63/221 - (28%)
Similarity:83/221 - (37%) Gaps:67/221 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 SKDNVDLVSRSEYARLCDGGSDCILQSGSASGAASHPSLRDDEFLQHSSLWGHQFISGGMGEG-- 131
            |...||.||.::..||..|..:   |.|.|.....:|:      .|.:::.|...|.||..||  
Zfish    27 SPRTVDQVSEADIQRLLHGVME---QLGIARPRVEYPA------HQATNIVGPLSIQGGAHEGLQ 82

  Fly   132 --------PN--------RYPTIVKNDAGLPAYCNPPNPCPEGYDMETQGGSCIVDFENTAIFSR 180
                    ||        ..|.....|.|.|   :||||||.|   :|....|:.:..:||.|||
Zfish    83 HLGPYGNIPNIVAELTGDSVPKDFSEDHGYP---DPPNPCPLG---KTAADGCLENSPDTAEFSR 141

  Fly   181 EFQAAQDCTCDNEHMFDCSEQDSADVGGDKGDLNSAVEQYIMQMGQENSLNNVNSLAKKAGYPVM 245
            |||       .::|:||......|....:||.|                      ..|..|.|  
Zfish   142 EFQ-------KHQHLFDPEHDYPALAKWNKGLL----------------------YEKLKGGP-- 175

  Fly   246 PDPRLDDAVINPFLQGDRLP-IAAKK 270
              .|...:|.||:|.|.||. :.|||
Zfish   176 --KRRKRSVPNPYLMGQRLDNVVAKK 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
7B2NP_001014608.1 Secretogranin_V 45..275 CDD:283048 63/221 (29%)
scg5NP_957020.1 Secretogranin_V 30..199 CDD:310120 60/216 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170594654
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4187
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 45 1.000 Inparanoid score I5478
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1534994at2759
OrthoFinder 1 1.000 - - FOG0007944
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108923
Panther 1 1.100 - - LDO PTHR12738
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4405
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1110.790

Return to query results.
Submit another query.