DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment 7B2 and Scg5

DIOPT Version :9

Sequence 1:NP_001014608.1 Gene:7B2 / 40644 FlyBaseID:FBgn0041707 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_037307.2 Gene:Scg5 / 25719 RGDID:3669 Length:210 Species:Rattus norvegicus


Alignment Length:227 Identity:68/227 - (29%)
Similarity:89/227 - (39%) Gaps:68/227 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 NEAAAGSKDNVDLVSRSEYARLCDGGSDCILQSGSASGAASHPSLRDDEFLQHSSLWGHQFISGG 127
            |.|.|.|....|.||.::..||..|..:   |.|.|.....:|:      .|..:|.|.|.|.||
  Rat    20 NPAFAYSPRTPDRVSETDIQRLLHGVME---QLGIARPRVEYPA------HQAMNLVGPQSIEGG 75

  Fly   128 MGEG----------PN--------RYPTIVKNDAGLPAYCNPPNPCPEGYDMETQGGSCIVDFEN 174
            ..||          ||        ..|.....|.|.|   :||||||.|   :|....|:.:..:
  Rat    76 AHEGLQHLGPFGNIPNIVAELTGDNIPKDFSEDQGYP---DPPNPCPLG---KTADDGCLENAPD 134

  Fly   175 TAIFSREFQAAQDCTCDNEHMFDCSEQDSADVGGDKGDLNSAVEQYIMQMGQENSLNNVNSLAKK 239
            ||.||||||.       ::|:|| .|.|...:|  |.:.....|:  |:.||.....:|      
  Rat   135 TAEFSREFQL-------DQHLFD-PEHDYPGLG--KWNKKLLYEK--MKGGQRRKRRSV------ 181

  Fly   240 AGYPVMPDPRLDDAVINPFLQGDRLP-IAAKK 270
                            ||:|||.||. :.|||
  Rat   182 ----------------NPYLQGKRLDNVVAKK 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
7B2NP_001014608.1 Secretogranin_V 45..275 CDD:283048 68/227 (30%)
Scg5NP_037307.2 Secretogranin_V 22..197 CDD:368368 65/223 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166352705
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4187
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 52 1.000 Inparanoid score I5363
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1534994at2759
OrthoFinder 1 1.000 - - FOG0007944
OrthoInspector 1 1.000 - - oto96310
orthoMCL 1 0.900 - - OOG6_108923
Panther 1 1.100 - - LDO PTHR12738
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.760

Return to query results.
Submit another query.