DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment 7B2 and Scg5

DIOPT Version :9

Sequence 1:NP_001014608.1 Gene:7B2 / 40644 FlyBaseID:FBgn0041707 Length:276 Species:Drosophila melanogaster
Sequence 2:XP_036015750.1 Gene:Scg5 / 20394 MGIID:98289 Length:215 Species:Mus musculus


Alignment Length:227 Identity:68/227 - (29%)
Similarity:89/227 - (39%) Gaps:68/227 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 NEAAAGSKDNVDLVSRSEYARLCDGGSDCILQSGSASGAASHPSLRDDEFLQHSSLWGHQFISGG 127
            |.|.|.|....|.||.::..||..|..:   |.|.|.....:|:      .|..:|.|.|.|.||
Mouse    25 NPAFAYSPRTPDRVSETDIQRLLHGVME---QLGIARPRVEYPA------HQAMNLVGPQSIEGG 80

  Fly   128 MGEG----------PN--------RYPTIVKNDAGLPAYCNPPNPCPEGYDMETQGGSCIVDFEN 174
            ..||          ||        ..|.....|.|.|   :||||||.|   :|....|:.:..:
Mouse    81 AHEGLQHLGPFGNIPNIVAELTGDNIPKDFSEDQGYP---DPPNPCPLG---KTADDGCLENAPD 139

  Fly   175 TAIFSREFQAAQDCTCDNEHMFDCSEQDSADVGGDKGDLNSAVEQYIMQMGQENSLNNVNSLAKK 239
            ||.||||||.       ::|:|| .|.|...:|  |.:.....|:  |:.||.....:|      
Mouse   140 TAEFSREFQL-------DQHLFD-PEHDYPGLG--KWNKKLLYEK--MKGGQRRKRRSV------ 186

  Fly   240 AGYPVMPDPRLDDAVINPFLQGDRLP-IAAKK 270
                            ||:|||.||. :.|||
Mouse   187 ----------------NPYLQGKRLDNVVAKK 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
7B2NP_001014608.1 Secretogranin_V 45..275 CDD:283048 68/227 (30%)
Scg5XP_036015750.1 Secretogranin_V 27..202 CDD:368368 65/223 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167849094
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4187
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 51 1.000 Inparanoid score I5456
Isobase 1 0.950 - 0 Normalized mean entropy S6844
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007944
OrthoInspector 1 1.000 - - oto92752
orthoMCL 1 0.900 - - OOG6_108923
Panther 1 1.100 - - LDO PTHR12738
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4405
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1312.730

Return to query results.
Submit another query.