DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG14667 and DOT5

DIOPT Version :9

Sequence 1:	NP_001014607.1	Gene:	CG14667 / 40643	FlyBaseID:	FBgn0037317	Length:	337	Species:	Drosophila melanogaster
Sequence 2:	NP_172787.1	Gene:	DOT5 / 837889	AraportID:	AT1G13290	Length:	302	Species:	Arabidopsis thaliana

Alignment Length:	139	Identity:	30/139 - (21%)
Similarity:	45/139 - (32%)	Gaps:	39/139 - (28%)

- Green bases have known domain annotations that are detailed below.

  Fly   209 FPCPECPQTFNKKALLKQHR----------------TQVHLINRRFQCTICHEA----------- 246
            |.|..|.:|||:...::.|.                |:......|..|..|.|.
plant   101 FSCSVCNKTFNRFNNMQMHMWGHGSQYRKGPESLRGTKSSSSILRLPCYCCAEGCKNNIDHPRSK 165

  Fly   247 ----FASLGAKLRHDKAHKNERPYPC-LECGMIFSSVSELQNHFSTHSKQIRKFRCEPCNMDFIT 306
                |.:|..   |.|.....:|:.| .:|...|:    ::..:.||.|...|.....|..||..
plant   166 PLKDFRTLQT---HYKRKHGAKPFRCRKKCEKTFA----VRGDWRTHEKNCGKLWFCVCGSDFKH 223

  Fly   307 RRGLVAHTK 315
            :|.|..|.:
plant   224 KRSLKDHVR 232

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG14667	NP_001014607.1	zf-AD	6..80	CDD:214871
		C2H2 Zn finger	179..199	CDD:275368
		C2H2 Zn finger	211..232	CDD:275368	7/36 (19%)
		C2H2 Zn finger	240..260	CDD:275368	7/34 (21%)
		zf-C2H2_8	243..313	CDD:292531	19/85 (22%)
		C2H2 Zn finger	268..288	CDD:275368	3/20 (15%)
		C2H2 Zn finger	297..316	CDD:275368	6/19 (32%)
DOT5	NP_172787.1	None
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	1	1.050	62	1.000	Inparanoid score	I2531
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	1.050