DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14667 and Ctcfl

DIOPT Version :9

Sequence 1:NP_001014607.1 Gene:CG14667 / 40643 FlyBaseID:FBgn0037317 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_001342114.1 Gene:Ctcfl / 664799 MGIID:3652571 Length:646 Species:Mus musculus


Alignment Length:392 Identity:78/392 - (19%)
Similarity:136/392 - (34%) Gaps:111/392 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 QRDRNIF-----------IHMRGKYLGQLKLITGVELT----RNQGL------------PEIVCE 55
            :.||.|.           :|::|  ||.|.:....||:    ..:|:            |::..:
Mouse    64 ESDRRILTLQTVHLESQDVHLQG--LGWLSVPHSEELSGTVPEAEGILQLPSVLWLDPEPQLSLQ 126

  Fly    56 RCFS-----------ELDLATKFRERCIFSQKYLLDIIKKTSDQSTVHVELSSEPLDEQLI---- 105
            .|.:           ||             |:....::::....:..:.||:.: |||...    
Mouse   127 HCVTVSIPEELYPPEEL-------------QRIHFHLLRENVLMAEENPELTPD-LDESTALKKP 177

  Fly   106 ---DADQL----ETHYDDDQYVCYQGTKEEHQDLE--------EIELDDDPSAA---VIAAAEAA 152
               :.|||    ||...:::.:..:...:|.:|.|        .:|...||.||   .:..|:||
Mouse   178 EEDEKDQLPPQGETDKREERLLLLEMKPKEGKDDEIVLTISHLSLEEQQDPPAANQTSVPGAKAA 242

  Fly   153 AEAAQQEDLQEQEMERAAKRRSNFFICDECGTLFHDAFLYTEHLNGHQNRRD------MNQF--- 208
                      :.:..|..|.:...|.||.|.........:..|:..|.|.|.      :..|   
Mouse   243 ----------KPKRRRQTKGKPQSFQCDTCPFTSSKLSTFNRHIKIHSNERPHLCHLCLKAFRTV 297

  Fly   209 ---------------FPCPECPQTFNKKALLKQHRTQVHLINRRFQCTICHEAFASLGAKLRHDK 258
                           ..|.:|...|.....|.:||...|...:.|:|::|..|........||.:
Mouse   298 TLLRNHVNTHTGTRPHKCRDCDMAFVTSGELVRHRRYKHTYEKPFKCSLCKYASVEASKMKRHIR 362

  Fly   259 AHKNERPYPCLECGMIFSSVSELQNHFSTHSKQIRKFRCEPCNMDFITRRGLVAHTKTAPHKRLA 323
            :|..|||:.|.:|........:|:.|..|||.: :.:.|..|::.|.....:..|......:.:.
Mouse   363 SHTGERPFQCCQCAYASRDSYKLKRHMRTHSGE-KPYECPTCHVRFTQSGTMKIHIAQKHGENVP 426

  Fly   324 KY 325
            ||
Mouse   427 KY 428

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14667NP_001014607.1 zf-AD 6..80 CDD:214871 16/99 (16%)
C2H2 Zn finger 179..199 CDD:275368 4/19 (21%)
C2H2 Zn finger 211..232 CDD:275368 6/20 (30%)
C2H2 Zn finger 240..260 CDD:275368 5/19 (26%)
zf-C2H2_8 243..313 CDD:292531 18/69 (26%)
C2H2 Zn finger 268..288 CDD:275368 4/19 (21%)
C2H2 Zn finger 297..316 CDD:275368 4/18 (22%)
CtcflNP_001342114.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 17..38
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 160..195 10/35 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 222..257 10/44 (23%)
COG5048 <256..491 CDD:227381 39/174 (22%)
C2H2 Zn finger 259..279 CDD:275368 4/19 (21%)
C2H2 Zn finger 287..307 CDD:275368 1/19 (5%)
C2H2 Zn finger 315..333 CDD:275368 5/17 (29%)
C2H2 Zn finger 344..364 CDD:275368 5/19 (26%)
C2H2 Zn finger 372..392 CDD:275368 4/19 (21%)
C2H2 Zn finger 400..417 CDD:275368 3/16 (19%)
C2H2 Zn finger 460..480 CDD:275368
C2H2 Zn finger 488..508 CDD:275368
C2H2 Zn finger 516..534 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24406
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.