DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14667 and CG18764

DIOPT Version :9

Sequence 1:NP_001014607.1 Gene:CG14667 / 40643 FlyBaseID:FBgn0037317 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_652712.2 Gene:CG18764 / 59239 FlyBaseID:FBgn0042205 Length:409 Species:Drosophila melanogaster


Alignment Length:405 Identity:95/405 - (23%)
Similarity:161/405 - (39%) Gaps:96/405 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 CRICANKIMGHQRDRNIFIHMRGKYLGQLKLITGVELTRNQGLPEIVCERCFSELDLATKFRERC 71
            ||.|.: |:.::..:|:|.....|.|..:.|:||..|..:..||..:|..|..:|:.|..|||||
  Fly     5 CRTCGS-IIYNKMPKNLFHIENEKMLQDINLVTGTTLHNDPELPSSICACCTLDLNQAILFRERC 68

  Fly    72 IFSQKYLLDIIKKTSDQS---TVHVELSSEPLD-----------------EQLIDADQLETHY-- 114
            |.:||.|  :.::.|.::   ...||..:.|.|                 |:::|.|. :.|:  
  Fly    69 ILTQKQL--VHRRRSPEAKEPAEDVEEMASPPDCLNDPFGEVDEYIVESPEEVLDHDS-DAHHDL 130

  Fly   115 DDDQYV-----------CYQGTKEEHQDLE----------------------------------- 133
            |:|.|:           ..:..:|:.||:|                                   
  Fly   131 DEDNYIDSVEDVDALQDMAEVAEEDSQDVESLISSVQKELESICNDDSNSDNNDYMEPQNGSYFN 195

  Fly   134 ----EIELDDDPSAAVIAAAEAAAEAAQ---------------QEDLQEQEMERAAKRRSNFFIC 179
                |.|:..:|:..:..:..||..:.:               :...:||.:||...:|....:|
  Fly   196 ETINEYEVSSNPNTPLPESKSAAGRSTKPATTKPKRKKQYVTWKNMTEEQIIERKRLQRKRECVC 260

  Fly   180 DECGTLFHDAFLYTEHLNGHQNRRDMNQFFPCPECPQTFNKKALLKQHRTQVHLINRRFQCTICH 244
            ::||..|.|...:..|:..|..    |:.|.|.:|.:.|....|:..|:..:|...:.:.|..|.
  Fly   261 EQCGRQFTDQSNFKLHMLRHTG----NKNFACQQCGKRFYTDHLMTLHQRIIHQGEKPYDCRFCT 321

  Fly   245 EAFASLGAKLRHDKAHKNERPYPCLECGMIFSSVSELQNHFSTHSKQIRKFRCEPCNMDFITRRG 309
            ::|.:...:|.|::.|.|.:||.|..|...|.|.|..:.|...|: .:|.|.|..|...|.....
  Fly   322 KSFHNSNTRLIHERTHTNAKPYSCHHCDKCFKSASGRKRHELIHT-GVRAFACTICKQSFQRNTH 385

  Fly   310 LVAHTKTAPHKRLAK 324
            |.||.::..|...||
  Fly   386 LKAHLRSKFHTAKAK 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14667NP_001014607.1 zf-AD 6..80 CDD:214871 27/72 (38%)
C2H2 Zn finger 179..199 CDD:275368 6/19 (32%)
C2H2 Zn finger 211..232 CDD:275368 5/20 (25%)
C2H2 Zn finger 240..260 CDD:275368 5/19 (26%)
zf-C2H2_8 243..313 CDD:292531 21/69 (30%)
C2H2 Zn finger 268..288 CDD:275368 6/19 (32%)
C2H2 Zn finger 297..316 CDD:275368 6/18 (33%)
CG18764NP_652712.2 zf-AD 4..75 CDD:214871 26/70 (37%)
C2H2 Zn finger 260..280 CDD:275368 6/19 (32%)
zf-H2C2_2 272..297 CDD:290200 7/28 (25%)
C2H2 Zn finger 288..309 CDD:275368 5/20 (25%)
C2H2 Zn finger 317..337 CDD:275368 5/19 (26%)
C2H2 Zn finger 345..365 CDD:275368 6/19 (32%)
C2H2 Zn finger 373..391 CDD:275368 6/17 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 48 1.000 Domainoid score I19075
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I2531
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.