DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14667 and Repin1

DIOPT Version :9

Sequence 1:NP_001014607.1 Gene:CG14667 / 40643 FlyBaseID:FBgn0037317 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_001073372.2 Gene:Repin1 / 58887 MGIID:1889817 Length:601 Species:Mus musculus


Alignment Length:140 Identity:45/140 - (32%)
Similarity:61/140 - (43%) Gaps:6/140 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   177 FICDECGTLFHDAFLYTEHLNGHQNRRDMNQFFPCPECPQTFNKKALLKQHRTQVHLINRRFQCT 241
            |.|.|||..|........|...|...|.    |.|.||.:.|::.:.|..||.. |...|.|.|.
Mouse   437 FACTECGKNFGKKTHLVAHSRVHSGERP----FACEECGRRFSQGSHLAAHRRD-HAPERPFVCP 496

  Fly   242 ICHEAFASLGAKLRHDKAHKNERPYPCLECGMIFSSVSELQNHFSTHSKQIRKFRCEPCNMDFIT 306
            .|.:||........|.:.|..|:||.|.:||..||..|.|.:|...|:.: |.:.|..|:..|..
Mouse   497 DCGKAFRHKPYLAAHRRIHTGEKPYVCPDCGKAFSQKSNLVSHRRIHTGE-RPYACPDCDRSFSQ 560

  Fly   307 RRGLVAHTKT 316
            :..|:.|.|:
Mouse   561 KSNLITHRKS 570

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14667NP_001014607.1 zf-AD 6..80 CDD:214871
C2H2 Zn finger 179..199 CDD:275368 6/19 (32%)
C2H2 Zn finger 211..232 CDD:275368 7/20 (35%)
C2H2 Zn finger 240..260 CDD:275368 5/19 (26%)
zf-C2H2_8 243..313 CDD:292531 22/69 (32%)
C2H2 Zn finger 268..288 CDD:275368 8/19 (42%)
C2H2 Zn finger 297..316 CDD:275368 5/18 (28%)
Repin1NP_001073372.2 C2H2 Zn finger 110..130 CDD:275368
C2H2 Zn finger 138..158 CDD:275368
C2H2 Zn finger 169..189 CDD:275368
C2H2 Zn finger 198..216 CDD:275368
C2H2 Zn finger 230..250 CDD:275368
C2H2 Zn finger 287..307 CDD:275368
zf-H2C2_2 299..324 CDD:290200
COG5048 <303..574 CDD:227381 45/140 (32%)
C2H2 Zn finger 315..335 CDD:275368
zf-H2C2_2 327..352 CDD:290200
C2H2 Zn finger 343..363 CDD:275368
C2H2 Zn finger 411..431 CDD:275368
zf-H2C2_2 424..446 CDD:290200 5/8 (63%)
C2H2 Zn finger 439..459 CDD:275368 6/19 (32%)
zf-H2C2_2 451..476 CDD:290200 8/28 (29%)
C2H2 Zn finger 467..487 CDD:275368 7/20 (35%)
C2H2 Zn finger 495..515 CDD:275368 5/19 (26%)
zf-H2C2_2 507..532 CDD:290200 9/24 (38%)
C2H2 Zn finger 523..543 CDD:275368 8/19 (42%)
zf-H2C2_2 535..560 CDD:290200 7/25 (28%)
C2H2 Zn finger 551..571 CDD:275368 6/20 (30%)
C2H2 Zn finger 579..599 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167847940
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24406
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.