DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14667 and CG4936

DIOPT Version :9

Sequence 1:NP_001014607.1 Gene:CG14667 / 40643 FlyBaseID:FBgn0037317 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_650862.1 Gene:CG4936 / 42393 FlyBaseID:FBgn0038768 Length:521 Species:Drosophila melanogaster


Alignment Length:476 Identity:95/476 - (19%)
Similarity:152/476 - (31%) Gaps:193/476 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VCRICANK-------IMGHQRDRNIFIHMRGKYLGQLKLITGVELTRNQGLPEIVCERCFSELDL 63
            |||:|..:       |.....:::: .||       ::...||.:.:....|:.:||:||..|.:
  Fly    22 VCRVCLQQPKEPMASIFNDDSEKDL-THM-------IRECGGVPIKQFDHYPDKICEKCFKVLKM 78

  Fly    64 ATKFRERCIFSQKYLLDII-----------KKTSDQSTV------HVELSSEP-LDEQLIDADQL 110
            |.||||.|..|..:|...:           ||.|:.:|.      ..|...|| .||:..|.|..
  Fly    79 AFKFRETCQRSYGHLRQFVGPVEVEQRPPEKKGSETATKLEPDVDPDEAEQEPEHDEEDEDVDLD 143

  Fly   111 ETHY---DD--------------------------------------------DQYVCYQG---- 124
            |:||   ||                                            |.|..|:|    
  Fly   144 ESHYAEADDAAETQGGVFHDEIEDGILVELEKDRIVHVKNEQVEEDGIIEEVYDVYETYEGDLIP 208

  Fly   125 -------------------------------TKEEHQDLEEIELDD------------------- 139
                                           |:..|:|..|::|:.                   
  Fly   209 DQGYDHEMADQALSELSAEIEYLDQVEHDQLTESAHEDDAEVDLNSTEEEFVPSKSVRASIHARN 273

  Fly   140 ------DPSAAVIAAAEAAAEAA----------------------------QQEDLQEQEMERAA 170
                  :|..:..:.|..|.|::                            .::|:...|:  .|
  Fly   274 ATKRRVNPRRSATSTASVAVESSTSKTTDRGNPLKVRRGNSDSAGSKMSIKSEKDISIGEV--LA 336

  Fly   171 KRRSNF-----------------FICDECGTLFHDAFLYTEHLNGHQNRRDMNQFFPCPECPQTF 218
            ::.|..                 :|||.||.::......|||:..|...:.    ..|..|...|
  Fly   337 RKHSGIKTKGGHKILLGDKKEFKYICDVCGNMYPSQSRLTEHIKVHSGVKP----HECEICGHCF 397

  Fly   219 NKKALLKQHRTQVHLINRRFQCTICHEAFASLGAKLRHDKAHKNERPYPCLECGMIFSSVSELQN 283
            .:...|.:| ...|..||.::|:.|..|||.|..:.:|.:.|.|||||.|..|...|:..:.|:.
  Fly   398 AQAQQLARH-MNTHTGNRPYKCSYCPAAFADLSTRNKHHRIHTNERPYECDVCHKTFTYTNTLKF 461

  Fly   284 HFSTHSKQIRKFRCEPCNMDF 304
            |...|:.: :...|:.|...|
  Fly   462 HKMIHTGE-KPHVCDVCGKGF 481

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14667NP_001014607.1 zf-AD 6..80 CDD:214871 23/80 (29%)
C2H2 Zn finger 179..199 CDD:275368 7/19 (37%)
C2H2 Zn finger 211..232 CDD:275368 5/20 (25%)
C2H2 Zn finger 240..260 CDD:275368 7/19 (37%)
zf-C2H2_8 243..313 CDD:292531 21/62 (34%)
C2H2 Zn finger 268..288 CDD:275368 5/19 (26%)
C2H2 Zn finger 297..316 CDD:275368 3/8 (38%)
CG4936NP_650862.1 zf-AD 22..95 CDD:214871 23/80 (29%)
C2H2 Zn finger 362..382 CDD:275368 7/19 (37%)
zf-H2C2_2 375..399 CDD:290200 7/27 (26%)
COG5048 386..>447 CDD:227381 21/65 (32%)
C2H2 Zn finger 390..410 CDD:275368 5/20 (25%)
zf-H2C2_2 403..426 CDD:290200 8/23 (35%)
C2H2 Zn finger 418..438 CDD:275368 7/19 (37%)
zf-H2C2_2 432..455 CDD:290200 10/22 (45%)
C2H2 Zn finger 446..466 CDD:275368 5/19 (26%)
zf-H2C2_2 459..481 CDD:290200 5/22 (23%)
C2H2 Zn finger 474..494 CDD:275368 3/8 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 84 1.000 Inparanoid score I1804
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.