DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14667 and CG17806

DIOPT Version :9

Sequence 1:NP_001014607.1 Gene:CG14667 / 40643 FlyBaseID:FBgn0037317 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_650658.1 Gene:CG17806 / 42142 FlyBaseID:FBgn0038548 Length:421 Species:Drosophila melanogaster


Alignment Length:412 Identity:85/412 - (20%)
Similarity:145/412 - (35%) Gaps:105/412 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LADVCRICANKIMGHQRDRNIFIHMRGKYLGQLKLITGVELTRNQGLPEIVCERCFSELDLATKF 67
            :..:||.|..:.   :..:::|.......|..:..:||..|....|:|..:|..|..:|:.|..|
  Fly     1 MTTLCRTCGQEA---EHAKSLFDKEARDVLSNILKLTGFWLRNQPGVPTRICLSCLLDLNDAIAF 62

  Fly    68 RERCIFSQKYLLDIIKKTSDQSTV----------------------------------------- 91
            |||||.:.....:...|..|..|.                                         
  Fly    63 RERCIRTNSSWFEKQGKQEDSDTETAREGGNNRLESRVDVMPISIAQPQRRRILPQRSKKVDGVP 127

  Fly    92 -----------------------------HVELSSEPLDEQLIDADQLET-HYDDDQYVCYQGTK 126
                                         .:::.|||   ||.....:|: ::::......|..|
  Fly   128 LKTVETPIYPLVVPEIPPADLVDPLRCEDPIQVKSEP---QLSSDYPVESMNHEEPASEMPQVMK 189

  Fly   127 EEHQDLE---EIE-----------LDDDP--SAAVIAAAEAAAEAAQQEDLQEQEMERAAKR--- 172
            ||.:.|:   |::           |::.|  ..|.|...::.....::|....:....||||   
  Fly   190 EEPRTLQVIGEVQKNRRKPRSKGCLEECPGKDMAKIENIDSTTNKTKEEKYATRNKWGAAKRAYA 254

  Fly   173 -RSNFFICDECGTLFHDAFLYTEHLNGHQNRRDMNQFFPCPECPQTFNKKALLKQHRTQVHLINR 236
             ....:.||:||..|.:...:..||..|:..::    |.|.||.:....:.||..|....|....
  Fly   255 LEHRLYFCDQCGKTFSEKGNFNVHLRRHKGTKE----FQCQECDRMEFTQHLLNLHVRIKHRGEL 315

  Fly   237 RFQCTICHEAFASLGAKLRHDKAHKN---ERPYPCLECGMIFSSVSELQNHFSTHSKQIRKFRCE 298
            .:.|..|.:.|.:...:|.|::.||.   .||:.|..|...|.:.:.|::|...|:.: :.|.||
  Fly   316 PYVCKYCGKRFDNCLKRLNHERNHKESPVHRPHVCSTCQKAFKTSTALKDHIVVHTGE-QPFHCE 379

  Fly   299 PCNMDFITRRGLVAHTKTAPHK 320
            .|...|..|..|..|.|:..|:
  Fly   380 LCQTFFNRRNALATHYKSKHHR 401

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14667NP_001014607.1 zf-AD 6..80 CDD:214871 20/73 (27%)
C2H2 Zn finger 179..199 CDD:275368 7/19 (37%)
C2H2 Zn finger 211..232 CDD:275368 6/20 (30%)
C2H2 Zn finger 240..260 CDD:275368 5/19 (26%)
zf-C2H2_8 243..313 CDD:292531 21/72 (29%)
C2H2 Zn finger 268..288 CDD:275368 5/19 (26%)
C2H2 Zn finger 297..316 CDD:275368 7/18 (39%)
CG17806NP_650658.1 zf-AD 4..76 CDD:285071 20/74 (27%)
zf-C2H2 260..282 CDD:278523 7/21 (33%)
C2H2 Zn finger 262..282 CDD:275368 7/19 (37%)
C2H2 Zn finger 290..311 CDD:275368 6/20 (30%)
COG5048 <298..>383 CDD:227381 23/85 (27%)
C2H2 Zn finger 319..339 CDD:275368 5/19 (26%)
C2H2 Zn finger 350..370 CDD:275368 5/19 (26%)
ZnF_U1 375..407 CDD:197732 10/27 (37%)
C2H2 Zn finger 378..396 CDD:275368 7/17 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 48 1.000 Domainoid score I19075
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I2531
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.