DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14667 and Cp190

DIOPT Version :9

Sequence 1:NP_001014607.1 Gene:CG14667 / 40643 FlyBaseID:FBgn0037317 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_524359.2 Gene:Cp190 / 41848 FlyBaseID:FBgn0000283 Length:1096 Species:Drosophila melanogaster


Alignment Length:105 Identity:30/105 - (28%)
Similarity:47/105 - (44%) Gaps:18/105 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   178 ICDECG--------TLFHDAFLYTEHLNGHQNRRDMNQFFPCPECPQTFNKKALLKQHRTQVHLI 234
            :|:.||        ..||   :|.|    ||.:..:..|..|..|.|::..|..|:.|..:||..
  Fly   506 LCEHCGWRSVNNRELHFH---MYME----HQTKSLLYTFAECALCNQSYRTKGELEAHINEVHTD 563

  Fly   235 NRRFQCTICHEAFASLGAKLRHDKAHKNERPYPCLECGMI 274
            :.:.||..|::.|.......||.|::..|:   .||.|:|
  Fly   564 DNKQQCIYCNKVFEQELQLYRHMKSYHKEQ---ALEDGII 600

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14667NP_001014607.1 zf-AD 6..80 CDD:214871
C2H2 Zn finger 179..199 CDD:275368 7/27 (26%)
C2H2 Zn finger 211..232 CDD:275368 6/20 (30%)
C2H2 Zn finger 240..260 CDD:275368 6/19 (32%)
zf-C2H2_8 243..313 CDD:292531 10/32 (31%)
C2H2 Zn finger 268..288 CDD:275368 4/7 (57%)
C2H2 Zn finger 297..316 CDD:275368
Cp190NP_524359.2 BTB 20..122 CDD:279045
BTB 31..127 CDD:197585
C2H2 Zn finger 540..568 CDD:275371 8/27 (30%)
C2H2 Zn finger 569..586 CDD:275371 4/16 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S5423
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.