DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14667 and CG6813

DIOPT Version :9

Sequence 1:NP_001014607.1 Gene:CG14667 / 40643 FlyBaseID:FBgn0037317 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_001163590.1 Gene:CG6813 / 41396 FlyBaseID:FBgn0037923 Length:294 Species:Drosophila melanogaster


Alignment Length:315 Identity:85/315 - (26%)
Similarity:140/315 - (44%) Gaps:38/315 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 CRICANKIMGHQRDRNIFIHMRGKYLGQLKLITGVELTRNQGLPEIVCERCFSELDLATKFRERC 71
            ||||:..    ....::|....|..:.|:..||||||:..:.:...:|..|...|..|.|||:||
  Fly     6 CRICSRS----DAPIDLFGPGNGHLVRQIHSITGVELSCKKEISGQMCTTCLDNLQAAIKFRQRC 66

  Fly    72 IFSQKYLLDIIKKTSDQSTVHVELSSEPLDEQLIDADQLETHYDDDQYVCYQGTKEEHQDLEEIE 136
            |.::|..|:.|:..|.      :.|::|:..:.||.:|:|:.. |:..:|     .|.:||..  
  Fly    67 IIAEKQNLERIECDSK------DCSTDPIIYEDIDDNQIESEL-DESILC-----PEVKDLPM-- 117

  Fly   137 LDDDPSAAVIAAAEAAAEAAQQEDLQEQEMERAAKRRSNFFICDECGTLFHDAFLYTEHLNGHQN 201
                |||..::|..:         |..|   ::....:..::|.:||.:.::...:.||...|..
  Fly   118 ----PSAEKVSAPTS---------LNHQ---KSIGGGTGPYVCPDCGRIINNKSNFQEHTLRHTG 166

  Fly   202 RRDMNQFFPCPECPQTFNKKALLKQHRTQVHLINRRFQCTICHEAFASLGAKLRHDKAHKNERPY 266
            .::.:..|  ..|.::|..:..|..| |::|...:.:.|..|...|:|.||:..|.:.|:|||.|
  Fly   167 IKNFHCVF--LNCERSFATRKELTSH-TRIHTGEQPYVCVYCPRRFSSSGARQEHHRRHRNERRY 228

  Fly   267 PCLECGMIFSSVSELQNHFSTHSKQIRKFRCEPCNMDFITRRGLVAHTKTAPHKR 321
            .|..|...|.|...|:.|...| ...|...|..|...|.....|:.|..:..|||
  Fly   229 ECDTCKKSFVSSGCLRKHKMIH-VDARNHYCYVCQKHFKRISHLMTHLSSNIHKR 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14667NP_001014607.1 zf-AD 6..80 CDD:214871 24/72 (33%)
C2H2 Zn finger 179..199 CDD:275368 5/19 (26%)
C2H2 Zn finger 211..232 CDD:275368 5/20 (25%)
C2H2 Zn finger 240..260 CDD:275368 7/19 (37%)
zf-C2H2_8 243..313 CDD:292531 23/69 (33%)
C2H2 Zn finger 268..288 CDD:275368 6/19 (32%)
C2H2 Zn finger 297..316 CDD:275368 5/18 (28%)
CG6813NP_001163590.1 zf-AD 6..76 CDD:285071 25/73 (34%)
C2H2 Zn finger 144..164 CDD:275368 5/19 (26%)
C2H2 Zn finger 172..194 CDD:275368 6/24 (25%)
zf-H2C2_2 186..211 CDD:290200 7/25 (28%)
UFD2 <256..>294 CDD:227443 8/27 (30%)
C2H2 Zn finger 258..280 CDD:275368 5/21 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 48 1.000 Domainoid score I19075
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I2531
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.