DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14667 and CG14711

DIOPT Version :9

Sequence 1:NP_001014607.1 Gene:CG14667 / 40643 FlyBaseID:FBgn0037317 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_650094.1 Gene:CG14711 / 41395 FlyBaseID:FBgn0037922 Length:377 Species:Drosophila melanogaster


Alignment Length:390 Identity:93/390 - (23%)
Similarity:162/390 - (41%) Gaps:89/390 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VCRICANKIMGHQRDRNIF----IHMRGKYLGQLKLITGVELTRNQGLPEIVCERCFSELDLATK 66
            :||||..:.:..:....:|    ...| :.:.:::.:..::|...|.:|.::|..|...|..|.|
  Fly     6 LCRICLTEDINSEAMAPLFDDNDAQCR-ELVRKIEEVGSIKLVPLQNIPSMLCYSCVERLTSAHK 69

  Fly    67 FRERCIFSQKYLLDIIKKTSDQSTVHVELSSEPLDE-QLIDADQLETHYDD-DQYVCYQGTKEE- 128
            |||.|..|:        :|...:.|..|:.|||.|| ..:.||.:|..|:. :.::  .|.::: 
  Fly    70 FRELCQESE--------RTFATNVVKAEMKSEPTDEVPHVVADNIEYIYESANDFI--DGVEDDI 124

  Fly   129 -HQDLEEIELDDDPSAAVIAAAEAAAEAAQQEDLQE-------------QEMERAAKRR------ 173
             .:::.|..|:|    .|...::|...:...:||.|             |.:||..|.:      
  Fly   125 GMENIMEEPLED----GVGETSQAYETSTVVDDLDEDDLLVPNSTDSDYQPIERCRKAKVRKTRM 185

  Fly   174 -------------------------------------SNFFICDECGTLFHDAFLYTEH--LNGH 199
                                                 |...:|:.||.      :|::.  ||.|
  Fly   186 TKRGRGRPRGASSGHPRSFSEERPPVQASFKSSPEVSSTNIMCEICGN------IYSKRAALNIH 244

  Fly   200 QNRRDMNQFFPCPECPQTFNKKALLKQHRTQVHLINRRFQCTICHEAFASLGAKLRHDKAHKNER 264
            ..|....:.|.|..|.::|...:.|.:| .:||...:.|.|..|:.:||...:.:||::.|.|||
  Fly   245 MRRHMAEKPFKCEICSKSFAGPSELNRH-IRVHTGEKPFLCKYCNRSFADRSSNIRHERTHTNER 308

  Fly   265 PYPCLECGMIFSSVSELQNHFSTHSKQIRKFRCEPCNMDFITRRGLVAHTKTAPHKRLAKYMQDE 329
            |:.|..||..||..:.|:||..||:.: :.|.|..||..|..:..|..|..|..|::...:.::|
  Fly   309 PFTCSTCGKAFSYSNVLKNHMLTHTGE-KPFLCRVCNKTFSRKHQLDQHLGTMTHQQTVIHHKNE 372

  Fly   330  329
              Fly   373  372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14667NP_001014607.1 zf-AD 6..80 CDD:214871 19/77 (25%)
C2H2 Zn finger 179..199 CDD:275368 6/21 (29%)
C2H2 Zn finger 211..232 CDD:275368 5/20 (25%)
C2H2 Zn finger 240..260 CDD:275368 6/19 (32%)
zf-C2H2_8 243..313 CDD:292531 26/69 (38%)
C2H2 Zn finger 268..288 CDD:275368 8/19 (42%)
C2H2 Zn finger 297..316 CDD:275368 6/18 (33%)
CG14711NP_650094.1 zf-AD 6..81 CDD:285071 19/83 (23%)
C2H2 Zn finger 228..248 CDD:275368 7/25 (28%)
zf-H2C2_2 240..264 CDD:290200 7/23 (30%)
COG5048 249..>362 CDD:227381 38/114 (33%)
C2H2 Zn finger 256..276 CDD:275368 5/20 (25%)
zf-H2C2_2 268..292 CDD:290200 7/24 (29%)
C2H2 Zn finger 284..304 CDD:275368 6/19 (32%)
zf-H2C2_2 299..321 CDD:290200 11/21 (52%)
C2H2 Zn finger 312..332 CDD:275368 8/19 (42%)
zf-H2C2_2 325..349 CDD:290200 10/24 (42%)
C2H2 Zn finger 340..362 CDD:275368 7/21 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I2531
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.