DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14667 and CG31388

DIOPT Version :9

Sequence 1:NP_001014607.1 Gene:CG14667 / 40643 FlyBaseID:FBgn0037317 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_650060.1 Gene:CG31388 / 41355 FlyBaseID:FBgn0051388 Length:446 Species:Drosophila melanogaster


Alignment Length:433 Identity:90/433 - (20%)
Similarity:151/433 - (34%) Gaps:126/433 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VCRICANKIMGHQRDRNIFIHMRGKYLGQLKLITGVELTRNQGLPEIVCERCFSELDLATKFRER 70
            :||.| :::......:|:|.......|.|::.:|.::|..:..||..:|:.|..:|.:|..||..
  Fly     4 ICRTC-SRMADPAVAKNLFDPSSSSVLRQIETLTNLQLKEDGKLPRFMCQDCQHDLQIAIDFRRV 67

  Fly    71 CIFSQKYLLDIIKKTSDQSTVHVELSSEPLDEQLID---------------ADQLETHYDDD--- 117
            ||.:|: ||::..:..::.    |.:.|.|.||.:|               .|:::..:|.:   
  Fly    68 CIEAQE-LLELQLRQVEKE----EEAFESLAEQWLDDCPDELSNLSPVLQLNDRMDFIFDPEPQD 127

  Fly   118 ---------------QYV-CYQGT---------------KEEHQDL--------EEIELDDDPSA 143
                           :|: .||..               ..||.|:        |...:|:..::
  Fly   128 KNTDELASIKTTTTTEYMNAYQSVASPQSSPELSTDSQLSNEHFDMGLSPESEPESEAIDNRDTS 192

  Fly   144 AVIAAAEAAAEAAQQEDLQEQEMERAAKRRSNFFICDECGTLFHDAFLYTEHLNGHQNRRDMNQF 208
            :....::...|....::|:..:...........|:||.|...|..|...|.|.    |..::...
  Fly   193 SSHTCSKCGLEFENVDELKLHKYHLHDIPPDTKFVCDHCDEGFRSAAALTRHC----NMINLPLT 253

  Fly   209 FPCPECPQTFNKKALLKQHRTQV-------------------------HLI----NRRFQCTICH 244
            ..|.:|...|:...||:.|:.:.                         ||:    .||.:|..|.
  Fly   254 HSCTKCKSQFHNHILLETHKQRCLRPPASQHVCHICGKHLTTAFNLKNHLVRHAGTRRHKCDQCS 318

  Fly   245 EAFASLGAKLRHDKAHKNERPYPC-LECGMIFSSVSELQNHFSTH---SKQI------------- 292
            .:|.:......|.|.|..||||.| ..||..|...|....|...|   ||:|             
  Fly   319 ASFYTAAELCSHQKTHTTERPYICRYNCGKTFRFCSARSMHERVHMDASKRIYQCEYCPKSYVTP 383

  Fly   293 -------------RKFRCEPCNMDFITRRGLVAHTKTAPHKRL 322
                         |...||.|.:.|.|.:...:|.|:..||.|
  Fly   384 SECRTHQKYHNLTRDHGCEICRISFKTAKHYRSHLKSNAHKTL 426

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14667NP_001014607.1 zf-AD 6..80 CDD:214871 21/73 (29%)
C2H2 Zn finger 179..199 CDD:275368 7/19 (37%)
C2H2 Zn finger 211..232 CDD:275368 6/45 (13%)
C2H2 Zn finger 240..260 CDD:275368 5/19 (26%)
zf-C2H2_8 243..313 CDD:292531 25/99 (25%)
C2H2 Zn finger 268..288 CDD:275368 6/20 (30%)
C2H2 Zn finger 297..316 CDD:275368 6/18 (33%)
CG31388NP_650060.1 zf-AD 4..76 CDD:285071 21/73 (29%)
C2H2 Zn finger 228..254 CDD:275368 8/29 (28%)
C2H2 Zn finger 286..306 CDD:275368 2/19 (11%)
C2H2 Zn finger 314..334 CDD:275368 5/19 (26%)
C2H2 Zn finger 342..363 CDD:275368 6/20 (30%)
C2H2 Zn finger 373..393 CDD:275368 0/19 (0%)
C2H2 Zn finger 401..419 CDD:275368 6/17 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 48 1.000 Domainoid score I19075
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 84 1.000 Inparanoid score I1804
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.050

Return to query results.
Submit another query.