DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14667 and Zif

DIOPT Version :9

Sequence 1:NP_001014607.1 Gene:CG14667 / 40643 FlyBaseID:FBgn0037317 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_001189188.1 Gene:Zif / 40795 FlyBaseID:FBgn0037446 Length:388 Species:Drosophila melanogaster


Alignment Length:377 Identity:86/377 - (22%)
Similarity:151/377 - (40%) Gaps:68/377 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 CRIC---ANKIM--------GHQRDRNIFIHMRGKYLGQLKLITGVELTRNQGLPEIVCERCFSE 60
            ||:|   :.::.        |.:....:.|.:.|        ::...|...:.:|:.:|:.|..|
  Fly    10 CRVCLAQSERLQRLDEIREEGEESPNEMLIQLLG--------VSYSNLNDREHIPDGICKSCKVE 66

  Fly    61 LDLATKFRERCIFSQKYLLDIIKKTS--DQSTVHV----ELSSEPLDEQLIDADQL----ETHYD 115
            |::|.:|||:.:..|..:.:..::..  |:|.|.:    :.|.:..||::...::.    |.|.:
  Fly    67 LNMAYQFREKALRKQMEIEEYCRELGLLDESDVMMIKEEDGSQQQCDEEMYILEETTTGEEEHQE 131

  Fly   116 D------------DQYVCYQGTKEEHQDLEEIELDDDPSAAVIAAAEAAAEA-AQQEDLQEQEME 167
            :            ||..|...|.|..:|...||::.|.:..|:.:.:...|. :||..|||....
  Fly   132 EKGHEEYLEVDTSDQQECIGDTIEYLEDNYTIEMNSDQTEIVLESEKQYEETPSQQLALQEAAKA 196

  Fly   168 RAAKRRSNF-----------------FICDECGTLFHDAFLYTEHLNGHQNRRDMNQFFPCPECP 215
            ....||...                 :|||.||..:.......|    |:.|.|....:.|..|.
  Fly   197 SLKARRGRVRRGLNSLTTSDGTEKGGYICDVCGNFYEKRGRMME----HRRRHDGICQYACELCD 257

  Fly   216 QTFNKKALLKQHRTQVHLINRRFQCTICHEAFASLGAKLRHDKAHKNERPYPCLECGMIFSSVSE 280
            ..|..:..|::|... |..::.::|:.|...|........|:..|:..:||.|..|...|:....
  Fly   258 AKFQVREQLRKHMYS-HTGSKPYKCSFCSRQFFYESVLKSHENVHRGIKPYVCKVCDKAFAYAHS 321

  Fly   281 LQNHFSTHSKQIRKFRCEPCNMDFITRRGLVAHTKTAPHKR---LAKYMQDE 329
            |..|...|| .|:.:||:.||.||.....:..|.:|..|:.   ||:.|:.|
  Fly   322 LTKHELIHS-DIKLYRCDYCNKDFRLLHHMRQHEETKLHQNAVMLAESMKVE 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14667NP_001014607.1 zf-AD 6..80 CDD:214871 17/83 (20%)
C2H2 Zn finger 179..199 CDD:275368 5/19 (26%)
C2H2 Zn finger 211..232 CDD:275368 5/20 (25%)
C2H2 Zn finger 240..260 CDD:275368 4/19 (21%)
zf-C2H2_8 243..313 CDD:292531 20/69 (29%)
C2H2 Zn finger 268..288 CDD:275368 5/19 (26%)
C2H2 Zn finger 297..316 CDD:275368 6/18 (33%)
ZifNP_001189188.1 zf-AD 9..87 CDD:285071 17/84 (20%)
C2H2 Zn finger 225..245 CDD:275368 6/23 (26%)
COG5048 <250..369 CDD:227381 32/120 (27%)
C2H2 Zn finger 253..273 CDD:275368 5/20 (25%)
zf-H2C2_2 266..288 CDD:290200 5/22 (23%)
C2H2 Zn finger 281..301 CDD:275368 4/19 (21%)
zf-H2C2_2 294..318 CDD:290200 7/23 (30%)
C2H2 Zn finger 309..329 CDD:275368 5/19 (26%)
C2H2 Zn finger 337..353 CDD:275368 5/15 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I2531
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG26139
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.970

Return to query results.
Submit another query.