DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14667 and CG17359

DIOPT Version :9

Sequence 1:NP_001014607.1 Gene:CG14667 / 40643 FlyBaseID:FBgn0037317 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_648679.1 Gene:CG17359 / 39549 FlyBaseID:FBgn0036396 Length:339 Species:Drosophila melanogaster


Alignment Length:371 Identity:79/371 - (21%)
Similarity:140/371 - (37%) Gaps:104/371 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNLADVCRIC-----------------ANKIMGHQRDRNIFIHMRGKYLGQLKLITGVELTRNQG 48
            |:::.:||:|                 :|::   |....:...|       |:..:|..:.:..|
  Fly     1 MDISQMCRVCRDESDCLLDIYTEPYASSNRV---QEQEPVLATM-------LRECSGCSVHKEDG 55

  Fly    49 LPEIVCERCFSELDLATKFRERC-----IFSQ-----------KYLLDIIKKTSDQSTVHV---- 93
            :|:.:|..|...:..|.:.|.:|     .|.|           :|.|:|......|..|.|    
  Fly    56 MPQFICVECAEAVRNAYRLRRQCRKSHQYFEQLRLMMKELDDIEYCLNIGDNIEPQMPVSVMEAG 120

  Fly    94 --ELSSEPLDEQLI-------DADQLETHYDDDQYVCYQGTKEEHQDLEEIELDDDPSAAVIAAA 149
              ..:||||..:|:       :...:.:...|:         .||:               :|.:
  Fly   121 KTPETSEPLLVELVQVKYMPPEPKPISSPLPDN---------NEHK---------------LAQS 161

  Fly   150 EAAAEAAQQEDLQEQEMERAAKRRSNFFICDEC----GTLFH--DAFLYTEHLNGHQNRRDMNQF 208
            .:.|:....:          :|||:..:..::.    ..|.|  |..::.....|...|  :...
  Fly   162 YSPAKTPHNK----------SKRRARSYSDNDSWSPDSELEHEDDDKIWNASKRGKPKR--VPGP 214

  Fly   209 FPCPECPQTFNKKALLKQHRTQVHLINRRFQCTICHEAFASLGAKLRHDKAHKNERPYPCLECGM 273
            :.|..|.|:|.:|..|:.| .::|...|.::|::|..:||..|....|.:.|..|||:.|..|..
  Fly   215 YRCKLCTQSFTQKQNLEIH-MRIHTGERPYKCSLCPRSFAQKGNLQSHTRCHTGERPFGCPNCPK 278

  Fly   274 IFSSVSELQNHFSTHSKQIRKFRCEPCNMDFITRRGL----VAHTK 315
            .|..|.:||.|..||:.: :.|:|..|...|....||    .|||:
  Fly   279 RFRQVGQLQVHTRTHTGE-QPFKCSKCQQSFKQLNGLQKHMSAHTR 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14667NP_001014607.1 zf-AD 6..80 CDD:214871 18/106 (17%)
C2H2 Zn finger 179..199 CDD:275368 3/25 (12%)
C2H2 Zn finger 211..232 CDD:275368 7/20 (35%)
C2H2 Zn finger 240..260 CDD:275368 6/19 (32%)
zf-C2H2_8 243..313 CDD:292531 24/73 (33%)
C2H2 Zn finger 268..288 CDD:275368 7/19 (37%)
C2H2 Zn finger 297..316 CDD:275368 8/23 (35%)
CG17359NP_648679.1 zf-AD 6..88 CDD:285071 16/91 (18%)
zf-C2H2 215..237 CDD:278523 7/22 (32%)
C2H2 Zn finger 217..237 CDD:275368 7/20 (35%)
zf-H2C2_2 229..254 CDD:290200 7/25 (28%)
C2H2 Zn finger 245..265 CDD:275368 6/19 (32%)
zf-H2C2_2 257..282 CDD:290200 8/24 (33%)
C2H2 Zn finger 273..293 CDD:275368 7/19 (37%)
zf-H2C2_2 286..310 CDD:290200 9/24 (38%)
C2H2 Zn finger 301..321 CDD:275368 5/19 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.