| Sequence 1: | NP_001014607.1 | Gene: | CG14667 / 40643 | FlyBaseID: | FBgn0037317 | Length: | 337 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001261124.1 | Gene: | CG10321 / 37464 | FlyBaseID: | FBgn0034643 | Length: | 855 | Species: | Drosophila melanogaster |
| Alignment Length: | 289 | Identity: | 57/289 - (19%) |
|---|---|---|---|
| Similarity: | 97/289 - (33%) | Gaps: | 66/289 - (22%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 96 SSEPLDEQLIDADQL--ETHYDDDQYVCYQGT--------------------------------K 126
Fly 127 EEHQDLEEIEL---DDDPSAAVIAAAEAAAEAAQQEDLQEQEMERAAKRRSNF------------ 176
Fly 177 ----------FICDECGTLFHDAFLYTEHLNGHQN--RRDMNQFFPCPECPQTFNKKALLKQHRT 229
Fly 230 QVHLINRRFQCTICHEAFASLGAKLRHDKAHKNERPYPC--LECGMIFSSVSELQNHFSTHSKQI 292
Fly 293 --RKFRCEPCNMDFITRRGLVAHTKTAPH 319 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG14667 | NP_001014607.1 | zf-AD | 6..80 | CDD:214871 | |
| C2H2 Zn finger | 179..199 | CDD:275368 | 5/19 (26%) | ||
| C2H2 Zn finger | 211..232 | CDD:275368 | 5/20 (25%) | ||
| C2H2 Zn finger | 240..260 | CDD:275368 | 8/19 (42%) | ||
| zf-C2H2_8 | 243..313 | CDD:292531 | 19/73 (26%) | ||
| C2H2 Zn finger | 268..288 | CDD:275368 | 7/21 (33%) | ||
| C2H2 Zn finger | 297..316 | CDD:275368 | 4/18 (22%) | ||
| CG10321 | NP_001261124.1 | zf-AD | 12..80 | CDD:214871 | |
| ASF1_hist_chap | <405..516 | CDD:304562 | 6/30 (20%) | ||
| C2H2 Zn finger | 627..647 | CDD:275368 | 5/19 (26%) | ||
| C2H2 Zn finger | 661..681 | CDD:275368 | 5/19 (26%) | ||
| C2H2 Zn finger | 690..710 | CDD:275368 | 8/19 (42%) | ||
| C2H2 Zn finger | 717..740 | CDD:275368 | 7/22 (32%) | ||
| C2H2 Zn finger | 750..767 | CDD:275368 | 3/16 (19%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| 0 | 0.000 | |||||