Sequence 1: | NP_001014607.1 | Gene: | CG14667 / 40643 | FlyBaseID: | FBgn0037317 | Length: | 337 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_872063.2 | Gene: | lst-5 / 353399 | WormBaseID: | WBGene00016890 | Length: | 346 | Species: | Caenorhabditis elegans |
Alignment Length: | 336 | Identity: | 75/336 - (22%) |
---|---|---|---|
Similarity: | 122/336 - (36%) | Gaps: | 107/336 - (31%) |
- Green bases have known domain annotations that are detailed below.
Fly 80 DIIKKTSDQSTVHVELSSEPLDEQLIDADQLETHYDDDQYVCYQGTKEEHQDLEEIELDDDPSAA 144
Fly 145 VIAA-AEAAAEAAQQED-------LQEQEMERAAKRR---------------------SNFFI-- 178
Fly 179 ---------------CDECGTLFHDAFLYTEH-LNGHQNRRDMNQFFPCPECPQTFNKKALLKQH 227
Fly 228 -----RTQVHL-------INRRF-----------------QCTICHEAFASLGAKLRHDKAHKNE 263
Fly 264 RPYPCL----ECGMIFSSVSELQNHFSTHSKQIRKFRCEPCNMDFITRRGLVAHTKTAPHKRLAK 324
Fly 325 YMQDEFDFIEL 335 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG14667 | NP_001014607.1 | zf-AD | 6..80 | CDD:214871 | 75/336 (22%) |
C2H2 Zn finger | 179..199 | CDD:275368 | 8/20 (40%) | ||
C2H2 Zn finger | 211..232 | CDD:275368 | 7/25 (28%) | ||
C2H2 Zn finger | 240..260 | CDD:275368 | 8/19 (42%) | ||
zf-C2H2_8 | 243..313 | CDD:292531 | 18/73 (25%) | ||
C2H2 Zn finger | 268..288 | CDD:275368 | 4/23 (17%) | ||
C2H2 Zn finger | 297..316 | CDD:275368 | 2/18 (11%) | ||
lst-5 | NP_872063.2 | C2H2 Zn finger | 111..132 | CDD:275368 | 2/20 (10%) |
C2H2 Zn finger | 147..168 | CDD:275368 | 8/20 (40%) | ||
C2H2 Zn finger | 177..197 | CDD:275368 | 6/19 (32%) | ||
C2H2 Zn finger | 208..227 | CDD:275368 | 3/18 (17%) | ||
C2H2 Zn finger | 235..255 | CDD:275368 | 8/19 (42%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR24406 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.100 |