DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14667 and CG10431

DIOPT Version :9

Sequence 1:NP_001014607.1 Gene:CG14667 / 40643 FlyBaseID:FBgn0037317 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_001286078.1 Gene:CG10431 / 35157 FlyBaseID:FBgn0032730 Length:762 Species:Drosophila melanogaster


Alignment Length:300 Identity:67/300 - (22%)
Similarity:106/300 - (35%) Gaps:83/300 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 IKKTSDQSTVHVELS--------SEPLDEQ------LIDADQLETHYDDDQYVCYQGTKEEHQDL 132
            :|..|::..|..|.|        :.|:.:|      ::|......|               |:||
  Fly   456 MKMESNRGLVATEQSEYWPLEWHNSPVSKQPRKKIDILDMQSSFLH---------------HKDL 505

  Fly   133 --EEIELD---DDPSAAVIAAAEA-AAEAAQQEDLQEQEMERAAKRRSNFFICDECGTLFHDAFL 191
              ...:|.   .||....:.|:.| .|...::..|:.::::...|.....::|..|...|     
  Fly   506 IPTATQLSAPAPDPQLVAVTASYAKLANRYRKLQLKCKKLKSPRKVHRKTYVCRMCRKGF----- 565

  Fly   192 YTEHLNGHQNRRDMNQFFP--------CPECPQTFNKKALLKQHRTQV----HLINRR----FQC 240
             ::..|.|.:||....|..        |..|.:.|..:..|:||...:    .|.|.|    |:|
  Fly   566 -SKFKNLHHHRRQKAHFVKLIPNFSGRCSGCLKFFRSRLGLRQHMRYICQSLSLKNHRRLQSFKC 629

  Fly   241 TICHE-AFASLGAKLRHD----------------KAHKNERPYPCLECGMI---FSSVSELQNHF 285
            ..|.. |||......||:                .:.|...|....||.:.   |.|::.|:.|.
  Fly   630 RHCQAIAFAHWRLYRRHELNCRPKKSKTKVQTAMNSKKKVTPTQVFECNICKKSFGSLNGLRQHN 694

  Fly   286 STHSKQIRKFRCEPCNMDFITRRGLVAHTK-----TAPHK 320
            .|||.: |:.:|..|...|..|.||..|.|     ..||:
  Fly   695 ITHSTE-RQHKCGICERVFKRRNGLSQHIKGYHLQLKPHE 733

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14667NP_001014607.1 zf-AD 6..80 CDD:214871
C2H2 Zn finger 179..199 CDD:275368 4/19 (21%)
C2H2 Zn finger 211..232 CDD:275368 6/24 (25%)
C2H2 Zn finger 240..260 CDD:275368 7/36 (19%)
zf-C2H2_8 243..313 CDD:292531 24/89 (27%)
C2H2 Zn finger 268..288 CDD:275368 6/22 (27%)
C2H2 Zn finger 297..316 CDD:275368 8/23 (35%)
CG10431NP_001286078.1 THAP 4..81 CDD:283206
zf-AD 123..192 CDD:214871
zf-C2H2_6 674..700 CDD:290623 9/25 (36%)
C2H2 Zn finger 677..697 CDD:275368 5/19 (26%)
C2H2 Zn finger 705..726 CDD:275368 8/20 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24406
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.