DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14667 and CG31441

DIOPT Version :9

Sequence 1:NP_001014607.1 Gene:CG14667 / 40643 FlyBaseID:FBgn0037317 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_731558.1 Gene:CG31441 / 326139 FlyBaseID:FBgn0051441 Length:341 Species:Drosophila melanogaster


Alignment Length:355 Identity:90/355 - (25%)
Similarity:146/355 - (41%) Gaps:55/355 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LADVCRICANKIMGHQ-RDRNIFIHMRGKYLGQLKLITGVELTRNQGLPEIVCERCFSELDLATK 66
            |..:||.|...:...| |...:|......::..|:.||.:.|..:..||.::|:.|..:||....
  Fly     4 LRSICRTCGKNVTNLQGRATKLFNKSNYHFISILENITDMYLEFDTTLPHLICQCCKVQLDRILT 68

  Fly    67 FRERCIFSQKYLLDIIKKTSDQSTVHVELSSEPLDEQLIDADQLETHYDDDQYVCYQGT----KE 127
            ||.:|:...|..:...:|...:..:..|...:|..|:|  ...|..|.|.:..|....|    :|
  Fly    69 FRNKCLEVHKSFMAANRKLLRKKAIVDEELDKPDVEKL--QQDLWDHTDQEMCVAMADTAGLLRE 131

  Fly   128 EHQDLEEIELDDDPSAAVIAAAEAAAEAAQQEDLQEQEME------------------------- 167
            :|.|.|:              |:.|.:|.|.|..||::::                         
  Fly   132 DHNDNEK--------------AKDAEDATQNEKNQEEQVQVQTEEVEHCQEQLHNMSIISKGVSA 182

  Fly   168 ---RAAKRRSNFFICDECGTLFHDAFLYTEHLNGHQNRRDMNQFFPCPECPQTFNKKALLKQHRT 229
               :..||.|..:.||:||.:|..:.....||..|...:.    |.|..|...:.....:::||.
  Fly   183 RVPKRTKRNSKSWFCDQCGGVFKSSTYLKLHLQRHSGHKP----FACDICQAKYYTDNEMRRHRI 243

  Fly   230 QVHLINRRFQCTICHEAFASLGAKLRHDKAHKNERPYPCLECGMIFSSVSELQNHFSTHSKQIRK 294
             :|...|.:.|..|.:.:....:|:.|::.|.||||:.|..|...|:|.|..|.|...|:.| ||
  Fly   244 -LHTDARPYACRFCSKTYRGCSSKVVHERTHTNERPFQCQHCDKAFTSTSTRQKHEMLHTNQ-RK 306

  Fly   295 FRCEPCNMDFITRRGLVAHTKTAPHKRLAK 324
            :.||.|:..|:....|..|..|..|:|.|:
  Fly   307 YHCEICDQWFLRSSHLTLHQSTKLHQRRAE 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14667NP_001014607.1 zf-AD 6..80 CDD:214871 20/74 (27%)
C2H2 Zn finger 179..199 CDD:275368 7/19 (37%)
C2H2 Zn finger 211..232 CDD:275368 4/20 (20%)
C2H2 Zn finger 240..260 CDD:275368 4/19 (21%)
zf-C2H2_8 243..313 CDD:292531 24/69 (35%)
C2H2 Zn finger 268..288 CDD:275368 7/19 (37%)
C2H2 Zn finger 297..316 CDD:275368 6/18 (33%)
CG31441NP_731558.1 zf-AD 7..82 CDD:285071 20/74 (27%)
COG5048 <174..337 CDD:227381 48/169 (28%)
C2H2 Zn finger 197..217 CDD:275370 7/19 (37%)
C2H2 Zn finger 225..245 CDD:275368 4/20 (20%)
C2H2 Zn finger 253..273 CDD:275368 4/19 (21%)
zf-H2C2_2 268..290 CDD:290200 9/21 (43%)
C2H2 Zn finger 281..301 CDD:275368 7/19 (37%)
C2H2 Zn finger 309..328 CDD:275368 6/18 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 48 1.000 Domainoid score I19075
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I2531
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG26139
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.060

Return to query results.
Submit another query.