DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14667 and Zfp189

DIOPT Version :9

Sequence 1:NP_001014607.1 Gene:CG14667 / 40643 FlyBaseID:FBgn0037317 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_001101400.1 Gene:Zfp189 / 313219 RGDID:1306510 Length:608 Species:Rattus norvegicus


Alignment Length:293 Identity:73/293 - (24%)
Similarity:118/293 - (40%) Gaps:83/293 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 QLIDADQLETHYDDDQYVCYQGTKEE-HQDLE---------EIELDDDPSAAVIAAAEAAAEAAQ 157
            :|:..|.|..:.|::..|     ||| .:|:|         :.|||.||..:  ...|......:
  Rat    35 KLVSLDVLNRNEDEEPTV-----KEEIEKDIEPQGIIVTRIKSELDQDPMGS--ETFELVGRLDK 92

  Fly   158 QEDL-----------QEQEM--------------------ERAAK---RRSNF------------ 176
            |..:           :||:|                    |...|   |:::|            
  Rat    93 QRGIFLWEIPRDSLTEEQKMFRGHTNVRKRPNSEEKCHKCEECGKRFVRKAHFIQHQRVHTGEKP 157

  Fly   177 FICDECGTLFHDAFLYTEHLNGHQNRRDMNQFFPCPECPQTFNKKALLKQHRTQVHLINRRFQCT 241
            |.|:|||..|..:....||...|...|.    :.|..|.:||:..:.|.:|: ::|...|.:||.
  Rat   158 FQCNECGKSFSRSSFVIEHQRIHTGERP----YECNYCGKTFSVSSTLIRHQ-RIHTGERPYQCN 217

  Fly   242 ICHEAFASLGAKLRHDKAHKNERPYPCLECGMIFSSVSELQNHFSTHSKQIRKFRCEPCNMDFIT 306
            .|.::|:...:.::|.:.|..|:|:.|.:||..||..|.|..|..||:.: :.:.|..|...| :
  Rat   218 QCKQSFSQRRSLVKHQRIHTGEKPHKCSDCGKAFSWKSHLIEHQRTHTGE-KPYHCTKCKKSF-S 280

  Fly   307 RRGLVA-----HTKTAPHK--------RLAKYM 326
            |..|:.     ||...|||        ||:.|:
  Rat   281 RNSLLVEHQRIHTGERPHKCGECGKAFRLSTYL 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14667NP_001014607.1 zf-AD 6..80 CDD:214871
C2H2 Zn finger 179..199 CDD:275368 7/19 (37%)
C2H2 Zn finger 211..232 CDD:275368 6/20 (30%)
C2H2 Zn finger 240..260 CDD:275368 4/19 (21%)
zf-C2H2_8 243..313 CDD:292531 21/74 (28%)
C2H2 Zn finger 268..288 CDD:275368 8/19 (42%)
C2H2 Zn finger 297..316 CDD:275368 7/23 (30%)
Zfp189NP_001101400.1 KRAB_A-box <10..39 CDD:143639 1/3 (33%)
COG5048 116..506 CDD:227381 53/205 (26%)
C2H2 Zn finger 132..152 CDD:275368 4/19 (21%)
zf-H2C2_2 144..169 CDD:290200 7/24 (29%)
C2H2 Zn finger 160..180 CDD:275368 7/19 (37%)
zf-H2C2_2 175..196 CDD:290200 7/24 (29%)
C2H2 Zn finger 188..208 CDD:275368 6/20 (30%)
zf-H2C2_2 201..225 CDD:290200 8/24 (33%)
C2H2 Zn finger 216..236 CDD:275368 4/19 (21%)
zf-H2C2_2 228..252 CDD:290200 7/23 (30%)
C2H2 Zn finger 244..264 CDD:275368 8/19 (42%)
zf-H2C2_2 256..281 CDD:290200 7/26 (27%)
C2H2 Zn finger 272..292 CDD:275368 5/20 (25%)
zf-H2C2_2 285..307 CDD:290200 5/21 (24%)
C2H2 Zn finger 300..320 CDD:275368 3/14 (21%)
zf-H2C2_2 312..337 CDD:290200 1/2 (50%)
C2H2 Zn finger 328..348 CDD:275368
zf-H2C2_2 341..365 CDD:290200
C2H2 Zn finger 356..376 CDD:275368
zf-H2C2_2 368..393 CDD:290200
C2H2 Zn finger 384..404 CDD:275368
C2H2 Zn finger 440..460 CDD:275368
zf-H2C2_2 452..477 CDD:290200
C2H2 Zn finger 468..488 CDD:275368
zf-H2C2_2 481..505 CDD:290200
C2H2 Zn finger 496..516 CDD:275368
zf-H2C2_2 508..533 CDD:290200
C2H2 Zn finger 524..544 CDD:275368
zf-H2C2_2 537..561 CDD:290200
C2H2 Zn finger 552..572 CDD:275368
C2H2 Zn finger 583..603 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.