DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14667 and REPIN1

DIOPT Version :9

Sequence 1:NP_001014607.1 Gene:CG14667 / 40643 FlyBaseID:FBgn0037317 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_001374966.1 Gene:REPIN1 / 29803 HGNCID:17922 Length:626 Species:Homo sapiens


Alignment Length:139 Identity:45/139 - (32%)
Similarity:63/139 - (45%) Gaps:6/139 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   177 FICDECGTLFHDAFLYTEHLNGHQNRRDMNQFFPCPECPQTFNKKALLKQHRTQVHLINRRFQCT 241
            |.|:|||..|...    .||..|:.....::.|.||:|.:.|..|..|..|| ::|...:.:.|.
Human   490 FACEECGRRFSQG----SHLAAHRRDHAPDRPFVCPDCGKAFRHKPYLAAHR-RIHTGEKPYVCP 549

  Fly   242 ICHEAFASLGAKLRHDKAHKNERPYPCLECGMIFSSVSELQNHFSTHSKQIRKFRCEPCNMDFIT 306
            .|.:||:.....:.|.:.|..||||.|.:|...||..|.|..|..:|.:. ..|.|..|...|..
Human   550 DCGKAFSQKSNLVSHRRIHTGERPYACPDCDRSFSQKSNLITHRKSHIRD-GAFCCAICGQTFDD 613

  Fly   307 RRGLVAHTK 315
            ...|:||.|
Human   614 EERLLAHQK 622

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14667NP_001014607.1 zf-AD 6..80 CDD:214871
C2H2 Zn finger 179..199 CDD:275368 7/19 (37%)
C2H2 Zn finger 211..232 CDD:275368 8/20 (40%)
C2H2 Zn finger 240..260 CDD:275368 5/19 (26%)
zf-C2H2_8 243..313 CDD:292531 22/69 (32%)
C2H2 Zn finger 268..288 CDD:275368 7/19 (37%)
C2H2 Zn finger 297..316 CDD:275368 7/19 (37%)
REPIN1NP_001374966.1 C2H2 Zn finger 118..138 CDD:275368
C2H2 Zn finger 146..166 CDD:275368
C2H2 Zn finger 177..197 CDD:275368
COG5048 <197..371 CDD:227381
C2H2 Zn finger 206..227 CDD:275368
C2H2 Zn finger 238..258 CDD:275368
COG5048 292..599 CDD:227381 37/113 (33%)
C2H2 Zn finger 297..317 CDD:275368
C2H2 Zn finger 325..345 CDD:275368
C2H2 Zn finger 353..373 CDD:275368
C2H2 Zn finger 436..456 CDD:275368
C2H2 Zn finger 464..484 CDD:275368
C2H2 Zn finger 492..512 CDD:275368 8/23 (35%)
C2H2 Zn finger 520..540 CDD:275368 8/20 (40%)
C2H2 Zn finger 548..568 CDD:275368 5/19 (26%)
C2H2 Zn finger 576..596 CDD:275368 7/19 (37%)
C2H2 Zn finger 604..624 CDD:275368 7/19 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165157534
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24406
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.