DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14667 and ace2

DIOPT Version :9

Sequence 1:NP_001014607.1 Gene:CG14667 / 40643 FlyBaseID:FBgn0037317 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_594109.1 Gene:ace2 / 2541661 PomBaseID:SPAC6G10.12c Length:533 Species:Schizosaccharomyces pombe


Alignment Length:299 Identity:59/299 - (19%)
Similarity:97/299 - (32%) Gaps:103/299 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 DVCRICANKIMGHQRDRNIFIHMR--GKYLGQLKLITGVELTRNQGLPEIVCERCFSELD----- 62
            ||||        |..::..|..:.  .:|:.:.:..:.|               |...||     
pombe   304 DVCR--------HTDNQKAFAKLSSPAEYVSEFEKFSSV---------------CDHGLDISNAN 345

  Fly    63 ----LATKFR-----ERCIFSQKYLLDIIKKTSDQSTVHVELSSEPLDEQLIDADQ---LETHYD 115
                |..:|.     |.||.::|....|..|..:|....:|.:...:..|:.:.|.   :...||
pombe   346 INNTLTQQFALSAPYESCIVTKKPEPCITVKEEEQLAPKIESADLSITPQVTEHDSKPPVRISYD 410

  Fly   116 DDQYVCYQGTKEEHQDLEEIELDDDPSAAVIAAAEAAAEAAQQEDLQEQEMERAAKRRSNFFICD 180
               :.|    |...|......:..:..|::....||..:                      ::| 
pombe   411 ---HRC----KTRKQSTRICRIPPETMASLYCGPEADGK----------------------YVC- 445

  Fly   181 ECGTLFHDAFLYTEHLNGHQNRRDMNQFFPCPECPQTFNKKALLKQHRTQVHLINRRFQCTICHE 245
                      ||    ||               |.:...:|..::.| .|.||.:|.::|.:|..
pombe   446 ----------LY----NG---------------CNKRIARKYNVESH-IQTHLSDRPYRCDLCKA 480

  Fly   246 AFASLGAKLRHDKAHKNERPYPCLECGMIFSSVSELQNH 284
            .|.......||.:.|:|.|||.| ||...|:.:..|..|
pombe   481 GFVRHHDLKRHLRIHENGRPYVC-ECLKRFNRLDALNRH 518

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14667NP_001014607.1 zf-AD 6..80 CDD:214871 16/89 (18%)
C2H2 Zn finger 179..199 CDD:275368 4/19 (21%)
C2H2 Zn finger 211..232 CDD:275368 4/20 (20%)
C2H2 Zn finger 240..260 CDD:275368 5/19 (26%)
zf-C2H2_8 243..313 CDD:292531 15/42 (36%)
C2H2 Zn finger 268..288 CDD:275368 6/17 (35%)
C2H2 Zn finger 297..316 CDD:275368
ace2NP_594109.1 COG5048 45..518 CDD:227381 58/297 (20%)
C2H2 Zn finger 448..467 CDD:275368 6/34 (18%)
zf-C2H2 473..495 CDD:278523 5/21 (24%)
C2H2 Zn finger 475..495 CDD:275368 5/19 (26%)
zf-H2C2_2 487..511 CDD:290200 11/24 (46%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 84 1.000 Inparanoid score I1804
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.