DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG14667 and C46E10.8

DIOPT Version :9

Sequence 1:	NP_001014607.1	Gene:	CG14667 / 40643	FlyBaseID:	FBgn0037317	Length:	337	Species:	Drosophila melanogaster
Sequence 2:	NP_001379807.1	Gene:	C46E10.8 / 173716	WormBaseID:	WBGene00016712	Length:	172	Species:	Caenorhabditis elegans

Alignment Length:	58	Identity:	17/58 - (29%)
Similarity:	24/58 - (41%)	Gaps:	7/58 - (12%)

- Green bases have known domain annotations that are detailed below.

  Fly   238 FQCTICHEAFASLGAKLRHDKAHKNER-------PYPCLECGMIFSSVSELQNHFSTH 288
            :||..|...:||..:...|.|::|..|       .:.|..||..:||...|..|...|
Worm    29 YQCKACSRIYASRKSLKSHLKSYKYAREVAGYKSKHTCEICGAHYSSKIYLNRHMKKH 86

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG14667	NP_001014607.1	zf-AD	6..80	CDD:214871
		C2H2 Zn finger	179..199	CDD:275368
		C2H2 Zn finger	211..232	CDD:275368
		C2H2 Zn finger	240..260	CDD:275368	6/19 (32%)
		zf-C2H2_8	243..313	CDD:292531	15/53 (28%)
		C2H2 Zn finger	268..288	CDD:275368	7/19 (37%)
		C2H2 Zn finger	297..316	CDD:275368
C46E10.8	NP_001379807.1	C2H2 Zn finger	31..64	CDD:275371	8/32 (25%)
		zf-C2H2	64..86	CDD:395048	7/21 (33%)
		C2H2 Zn finger	66..86	CDD:275371	7/19 (37%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	1	0.930	-	-		C160165468
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.930