Sequence 1: | NP_001014607.1 | Gene: | CG14667 / 40643 | FlyBaseID: | FBgn0037317 | Length: | 337 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001035776.1 | Gene: | Zfp692 / 103836 | MGIID: | 2144276 | Length: | 531 | Species: | Mus musculus |
Alignment Length: | 245 | Identity: | 67/245 - (27%) |
---|---|---|---|
Similarity: | 103/245 - (42%) | Gaps: | 50/245 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 85 TSDQSTVHVELSSEPLDEQLIDADQLETHYDDDQYVCYQGTKEEHQDLEEIELDDDPSAAVIAAA 149
Fly 150 EAAAEAAQQEDLQE---QEMERAAKRRSNFFICD--ECGTLFHDAFLYTEHLNGHQNRRDMNQ-F 208
Fly 209 FPCPE--CPQTFNKKALLKQHRTQVHLINRRFQCTICHEAFASLGAKLRHDKAHKNERPYPCLEC 271
Fly 272 GMIFSSVSELQNHFSTHSKQIR--KFRCEPCNMDFITRRGLVAH-TKTAP 318 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG14667 | NP_001014607.1 | zf-AD | 6..80 | CDD:214871 | |
C2H2 Zn finger | 179..199 | CDD:275368 | 7/21 (33%) | ||
C2H2 Zn finger | 211..232 | CDD:275368 | 10/22 (45%) | ||
C2H2 Zn finger | 240..260 | CDD:275368 | 4/19 (21%) | ||
zf-C2H2_8 | 243..313 | CDD:292531 | 18/71 (25%) | ||
C2H2 Zn finger | 268..288 | CDD:275368 | 5/19 (26%) | ||
C2H2 Zn finger | 297..316 | CDD:275368 | 7/19 (37%) | ||
Zfp692 | NP_001035776.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 155..249 | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 287..307 | 5/27 (19%) | |||
zf-C2H2_8 | 328..406 | CDD:292531 | 25/82 (30%) | ||
C2H2 Zn finger | 360..382 | CDD:275368 | 10/22 (45%) | ||
COG5048 | 383..>436 | CDD:227381 | 13/52 (25%) | ||
C2H2 Zn finger | 390..410 | CDD:275368 | 4/19 (21%) | ||
zf-H2C2_2 | 402..427 | CDD:290200 | 7/24 (29%) | ||
C2H2 Zn finger | 418..438 | CDD:275368 | 5/19 (26%) | ||
C2H2 Zn finger | 449..465 | CDD:275368 | 5/15 (33%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 474..531 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR24406 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.100 |