DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14667 and znf276

DIOPT Version :9

Sequence 1:NP_001014607.1 Gene:CG14667 / 40643 FlyBaseID:FBgn0037317 Length:337 Species:Drosophila melanogaster
Sequence 2:XP_002933710.1 Gene:znf276 / 100486887 XenbaseID:XB-GENE-983669 Length:570 Species:Xenopus tropicalis


Alignment Length:227 Identity:49/227 - (21%)
Similarity:79/227 - (34%) Gaps:33/227 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 HYDDDQYVCYQGTKEEHQDLEEIELDDDPSA-----AVIAA--AEAAAEAAQQEDLQE------- 163
            |..:|   |...:..:.|..||.|....||:     ..||.  .:...|..:.:.|.|       
 Frog   310 HSKED---CSDLSDGDFQSQEEGEPGQQPSSDDSFEPCIAKRNPQKKREPRKSQKLTEFREKKKP 371

  Fly   164 ------QEMERAAKRRSNFFIC--DECGTLFHDAFLYTEHLNGHQNR-RDMNQFFPCPE--CPQT 217
                  ::::|..:.....:.|  ..|..::..|....:|:..|... |:.    |||.  |.:.
 Frog   372 GPKPGWKKIKREREELPTIYKCPYQGCTAVYRGADGMKKHIKEHHEEVRER----PCPHPGCNKV 432

  Fly   218 FNKKALLKQHRTQVHLINRRFQCTICHEAFASLGAKLRHDKAHKNERPYPCLECGMIFSSVSELQ 282
            |.....|::|...:|...|...|..|.:||........|...|...:|..|..||......:.|:
 Frog   433 FMIDRYLQRHVKLIHTEERNHICDQCGQAFKQRKHLSVHQMRHSGAKPLQCEVCGFQCRQRASLK 497

  Fly   283 NHFSTHSKQI-RKFRCEPCNMDFITRRGLVAH 313
            .|.:.|..:. .:|.|:.|...|.....|..|
 Frog   498 YHMTKHKAEADLEFACDQCAKRFEKAHNLNVH 529

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14667NP_001014607.1 zf-AD 6..80 CDD:214871
C2H2 Zn finger 179..199 CDD:275368 4/21 (19%)
C2H2 Zn finger 211..232 CDD:275368 6/22 (27%)
C2H2 Zn finger 240..260 CDD:275368 5/19 (26%)
zf-C2H2_8 243..313 CDD:292531 17/70 (24%)
C2H2 Zn finger 268..288 CDD:275368 5/19 (26%)
C2H2 Zn finger 297..316 CDD:275368 5/17 (29%)
znf276XP_002933710.1 SFP1 <320..476 CDD:227516 32/159 (20%)
C2H2 Zn finger 427..447 CDD:275368 4/19 (21%)
C2H2 Zn finger 455..475 CDD:275368 5/19 (26%)
C2H2 Zn finger 483..503 CDD:275368 5/19 (26%)
C2H2 Zn finger 513..530 CDD:275368 5/17 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24406
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.