DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14667 and si:dkeyp-2e4.2

DIOPT Version :9

Sequence 1:NP_001014607.1 Gene:CG14667 / 40643 FlyBaseID:FBgn0037317 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_001122042.1 Gene:si:dkeyp-2e4.2 / 100149164 ZFINID:ZDB-GENE-030131-9307 Length:251 Species:Danio rerio


Alignment Length:271 Identity:58/271 - (21%)
Similarity:90/271 - (33%) Gaps:87/271 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 LTRNQGLPEIVCERCFSELDLATKFRERCIFSQKYLLDIIKKTSDQSTVHVELSSE-PLD----- 101
            |::.:|...:.|.|        .|:|.:           ..:|||||:...:...| |:.     
Zfish    29 LSKTEGSAALFCRR--------LKYRVK-----------TDQTSDQSSSDTDTEDELPISTSPTP 74

  Fly   102 -EQLI-------------DADQLETHYDDDQYVC--------YQGTKEEHQDLEEIELDDDPSAA 144
             |.||             ....:..|..:..|:|        .||..:||               
Zfish    75 GEDLICKLCGSEFGSNISMVRHMRIHTGETPYICEVCGKGFKRQGWLKEH--------------- 124

  Fly   145 VIAAAEAAAEAAQQEDLQEQEMERAAKR-RSNFFICDECGTLFHDAFLYTEHLNGHQNRRDMNQF 208
                               ..:....|| |.....||:|...|:.:.....|||.|:..|.    
Zfish   125 -------------------FRVHTGNKRKREKRLSCDQCEMKFNSSTALRSHLNKHRGERP---- 166

  Fly   209 FPCPECPQTFNKKALLKQHRTQVHLINRRFQCTICHEAFASLGAKLRHDKAHKNERPYPCLECGM 273
            |.|.:|.:|:..:..|.||....| .:::..|.:|...|....:..:|.:.|..||||.|..||.
Zfish   167 FACVQCDKTYFNQHDLNQHLRDCH-SDKKHGCYLCGNEFTRQSSLQKHMRIHTGERPYSCPHCGK 230

  Fly   274 IFSSVSELQNH 284
            .||....::.|
Zfish   231 TFSYKHSMKMH 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14667NP_001014607.1 zf-AD 6..80 CDD:214871 6/36 (17%)
C2H2 Zn finger 179..199 CDD:275368 7/19 (37%)
C2H2 Zn finger 211..232 CDD:275368 6/20 (30%)
C2H2 Zn finger 240..260 CDD:275368 4/19 (21%)
zf-C2H2_8 243..313 CDD:292531 14/42 (33%)
C2H2 Zn finger 268..288 CDD:275368 6/17 (35%)
C2H2 Zn finger 297..316 CDD:275368
si:dkeyp-2e4.2NP_001122042.1 C2H2 Zn finger 80..100 CDD:275368 0/19 (0%)
zf-H2C2_2 92..117 CDD:290200 3/24 (13%)
C2H2 Zn finger 108..128 CDD:275368 5/53 (9%)
C2H2 Zn finger 141..161 CDD:275368 7/19 (37%)
C2H2 Zn finger 169..217 CDD:275368 11/48 (23%)
zf-H2C2_2 209..234 CDD:290200 10/24 (42%)
C2H2 Zn finger 225..243 CDD:275368 6/17 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24406
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.