DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hd and donson

DIOPT Version :9

Sequence 1:NP_001303424.1 Gene:hd / 40642 FlyBaseID:FBgn0086695 Length:568 Species:Drosophila melanogaster
Sequence 2:XP_021331572.1 Gene:donson / 110439729 -ID:- Length:230 Species:Danio rerio


Alignment Length:208 Identity:52/208 - (25%)
Similarity:80/208 - (38%) Gaps:48/208 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 RPDDFIKLQRLKQKKNKLAARVSNN--NNRRPRHQVDETDKSKLLEA----KLAQKRKNPFA--- 68
            :|.:.::::|.:.:......:||:.  :..||      .....||.|    ....||:||||   
Zfish    13 KPSEVLRMRRQRARSEGPGGKVSSPALSGLRP------FSPGPLLTAPGRGNGGVKRRNPFASIE 71

  Fly    69 -----------------KSTADA--KKLRVDPQLADL--EPVVTASSCFVRETPT----RPAPAK 108
                             ||:|..  :|||.:|:...|  |.::.......:.|..    ..|...
Zfish    72 NTYSSPKKRALIQEDGRKSSAAGPDEKLREEPKTGALLREELLHTDRLKQQHTQAAVSLSEADGV 136

  Fly   109 FVLQKYDPQAFAKLFQHPQINAEDEDDAELAARQKHTAHLPVDWSLKTRARFFCPTELP-AIQLK 172
            |....:|||:.|.:.:.|:. ..|...:|:.      ...|.|||||||..|..|.... |..||
Zfish   137 FEDDLFDPQSSAAVLKSPEA-LRDSSPSEVC------VEYPADWSLKTRLLFTSPQSFSWAEHLK 194

  Fly   173 TSQLASGLTSFVR 185
            ..:.|.||:|..|
Zfish   195 AQEEAQGLSSHCR 207



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D479613at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.