DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cerk and AGK

DIOPT Version :9

Sequence 1:NP_649530.2 Gene:Cerk / 40640 FlyBaseID:FBgn0037315 Length:687 Species:Drosophila melanogaster
Sequence 2:NP_060708.1 Gene:AGK / 55750 HGNCID:21869 Length:422 Species:Homo sapiens


Alignment Length:375 Identity:78/375 - (20%)
Similarity:144/375 - (38%) Gaps:81/375 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   187 QELQIRLHSSSPTRMRVRRLLVFINPYGGRKAGAQTYERHVRPIFQLAGVDATCITTQRANQVKD 251
            ||.|:..:...|...:|::..||:||...:......:|::..||..|:|:|.|.:.|....|.|.
Human    44 QEAQVFGNQLIPPNAQVKKATVFLNPAACKGKARTLFEKNAAPILHLSGMDVTIVKTDYEGQAKK 108

  Fly   252 IL-LSHDLGVYDAVCCVGGDGTVAEVINGLIFRQMRELGLDEQRPPYIPRPALPVGVIPAGSTDT 315
            :| |..:.   |.:...|||||:.||:.| :.|:..|....:          :|:|.||.|.|.:
Human   109 LLELMENT---DVIIVAGGDGTLQEVVTG-VLRRTDEATFSK----------IPIGFIPLGETSS 159

  Fly   316 IAYSMHGTA-----DVRTAAIHVILGQHRGLDVCSVSNGQSLLRFCASVLSYGYLGDVAAQSENY 375
            :::::...:     .:..|.:.::.|:...|||..:...:....|..:.|.:|...|...:...|
Human   160 LSHTLFAESGNKVQHITDATLAIVKGETVPLDVLQIKGEKEQPVFAMTGLRWGSFRDAGVKVSKY 224

  Fly   376 RWMGPRRYE----YSGVKAFLNNRGYDAELRMLEEPDLLLTTPLEDIPQSPDSV----------- 425
            .::||.:.:    :|.:|          |.....:..:..|.|.|..|..|:..           
Human   225 WYLGPLKIKAAHFFSTLK----------EWPQTHQASISYTGPTERPPNEPEETPVQRPSLYRRI 279

  Fly   426 ------------CSLGESVPSVCYANCQRCSFASSIQEQRSSL---------------------- 456
                        .:|.:.|....:.:.|..:...||..:.:.|                      
Human   280 LRRLASYWAQPQDALSQEVSPEVWKDVQLSTIELSITTRNNQLDPTSKEDFLNICIEPDTISKGD 344

  Fly   457 FIQEESKEAERNQQVETEDSH-LAASEAALLRPRPRPGNLRLPTGSISSM 505
            ||...|::. ||.::..|.:. |.||:..||.|....|:..:.:....:|
Human   345 FITIGSRKV-RNPKLHVEGTECLQASQCTLLIPEGAGGSFSIDSEEYEAM 393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CerkNP_649530.2 PLN02204 157..658 CDD:215126 78/375 (21%)
AGKNP_060708.1 Hydrophobic. /evidence=ECO:0000305 15..31
DAGK_cat 62..195 CDD:395631 38/146 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 249..271 5/21 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.