DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cerk and F52C9.3

DIOPT Version :9

Sequence 1:NP_649530.2 Gene:Cerk / 40640 FlyBaseID:FBgn0037315 Length:687 Species:Drosophila melanogaster
Sequence 2:NP_498138.2 Gene:F52C9.3 / 175732 WormBaseID:WBGene00018674 Length:439 Species:Caenorhabditis elegans


Alignment Length:249 Identity:69/249 - (27%)
Similarity:103/249 - (41%) Gaps:54/249 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   170 RRLTFFNSDPYI----VRQWDQELQIRLH-----------SSSPTRMRVRRLLVFINPYGGRKAG 219
            ::..||:...|:    |.:||:...||..           :.|| ..|.:|:.|.:|..|..:..
 Worm    20 KKTIFFSFLGYLGADWVYRWDRNQGIRKEYAKIAVKYGETTVSP-ETRPKRVFVLVNVEGNSRGC 83

  Fly   220 AQTYERHVRPIFQLAGVDATCITTQRANQVKDILLSHDLGVYDAVCCVGGDGTVAEVINGLIFRQ 284
            ...:.::..|:|.||||....:......|::.:..:.|....|.:..||||||:..|:.| |||.
 Worm    84 FDQFNKNALPLFHLAGVQVDVVKADNQAQLEALAGAVDTQEADILYVVGGDGTIGTVVTG-IFRN 147

  Fly   285 MRELGLDEQRPPYIPRPALPVGVIPAGSTDTIAYSM-----HGTADVRTA---AIHVILGQHRGL 341
             ||            :..||||..|.|..:.....|     ..:.|||.|   |:.||..|.:.:
 Worm   148 -RE------------KAQLPVGFYPGGYDNLWLKRMLPSVFENSDDVRHACETAMAVIEDQKKSV 199

  Fly   342 DVCSVSNGQSLLRFCASVLSYGYLGDVAA----QSENYR---W---MGPRRYEY 385
            ....::...|.|     ...|| ||||:|    |.|:.|   |   |..||:.|
 Worm   200 YAFELTTEGSTL-----APEYG-LGDVSAGWFRQIEDTRKKFWYFSMAKRRWAY 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CerkNP_649530.2 PLN02204 157..658 CDD:215126 69/249 (28%)
F52C9.3NP_498138.2 DAGK_cat 69..>161 CDD:279163 31/105 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1597
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.