DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cerk and Sphk1

DIOPT Version :9

Sequence 1:NP_649530.2 Gene:Cerk / 40640 FlyBaseID:FBgn0037315 Length:687 Species:Drosophila melanogaster
Sequence 2:NP_001257740.1 Gene:Sphk1 / 170897 RGDID:620048 Length:458 Species:Rattus norvegicus


Alignment Length:241 Identity:61/241 - (25%)
Similarity:107/241 - (44%) Gaps:23/241 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   205 RLLVFINPYGGRKAGAQTYERHVRPIFQLAGVDATCITTQRANQVKDILLSHDLGVYDAVCCVGG 269
            |:||.:||.||:....:.::..|||:.:.|.|....:.|:|.|..::::.:.:||.:||:..:.|
  Rat    91 RVLVLLNPRGGKGKALKLFQSRVRPLLEEAEVSFKLMLTERQNHARELVCAEELGHWDALAVMSG 155

  Fly   270 DGTVAEVINGLIFRQMRELGLDEQRPPYIPRPALPVGVIPAGSTDTIA-----YSMHGTADVRTA 329
            ||.:.||:|||:           :||.:......|:..:|.||.:.:|     |:.|........
  Rat   156 DGLMHEVVNGLM-----------ERPDWESAIQKPLCSLPGGSGNALAASLNYYAGHEQVTNEDL 209

  Fly   330 AIHVIL----GQHRGLDVCSVSNGQSLLRFCASVLSYGYLGDVAAQSENYRWMGPRRYEYSGVKA 390
            .|:..|    .|...:::.|:........:....||:|::.||..:||.||.:|..|:.......
  Rat   210 LINCTLLLCCRQLSPMNLLSLHTASGRQLYSVLSLSWGFVADVDLESEKYRSLGEIRFTVGTFFR 274

  Fly   391 FLNNRGYDAELRMLEEPDLLLTTPLEDIPQSPDS---VCSLGESVP 433
            ..:.|.|..:|..|.........|...:.|...:   :..|.|.||
  Rat   275 LASLRIYQGQLAYLPVGKAASKIPASSLAQKGPANTYLVPLEEPVP 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CerkNP_649530.2 PLN02204 157..658 CDD:215126 61/241 (25%)
Sphk1NP_001257740.1 LCB5 91..443 CDD:224513 61/241 (25%)
DAGK_cat 91..197 CDD:279163 34/116 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166339913
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1597
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D681139at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.