DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CD180 and Tehao

DIOPT Version :9

Sequence 1:NP_005573.2 Gene:CD180 / 4064 HGNCID:6726 Length:661 Species:Homo sapiens
Sequence 2:NP_001285901.1 Gene:Tehao / 34761 FlyBaseID:FBgn0026760 Length:795 Species:Drosophila melanogaster


Alignment Length:674 Identity:141/674 - (20%)
Similarity:250/674 - (37%) Gaps:204/674 - (30%)


- Green bases have known domain annotations that are detailed below.


Human   105 TLVLTGNPLIF--------MAETSLNGPKSLKHLFLIQTGISNLEFIPVHNLENLESLYLGSNHI 161
            |....||.:.|        :.|.|..|..    |::.....:.|:::|..|:.:|..:...    
  Fly    39 TCAAEGNVVRFHCPDEYAMLLEVSEPGAS----LYMSYYASTELQWLPRFNISSLVKIEFD---- 95

Human   162 SSIKFPKDFPARNLKVLDFQNNAIHYISREDMRSLEQAINLSLNFNGNNVKGIELGAFDSTIFQS 226
            :.|.:|:.|.:..||.|..|  .:..|...| |:||..:...:..:||       |..:::..::
  Fly    96 AYIFWPEKFLSDLLKTLGVQ--TVKTIIFRD-RTLETVVTRDVLNSGN-------GYMETSQPEN 150

Human   227 L---NFGGTPNL-------------SVIFNGLQ----------------------NSTTQSLWLG 253
            :   :||..|.|             ..||:|..                      |.|.::|   
  Fly   151 ITTWHFGSVPGLKKFKFFSHVPELQESIFHGFDTLRDLHLSVNVTTLPGNMLSTVNGTLKTL--- 212

Human   254 TFEDIDDEDISSAMLKGLCEMSVESL-----------NLQEHRFSDISSTTFQCFTQLQELDLTA 307
            |.|........:.:|:.|.::...||           .||.|.|..:        |.|:|:.|.:
  Fly   213 TIESPGIVSFGNPLLRELQQLRNLSLALIHPFHERDKQLQPHFFGSM--------TNLEEVRLAS 269

Human   308 THLKGLPSGMKGLNLLKKLVLSVNHFDQLCQISAANFPSLTHLYIRGNVKKLHLGVGCLEKLGNL 372
            .......|..||.|.|:  ::.:|..|.|.::....|                     |::: ||
  Fly   270 ATSSVNRSMFKGTNKLQ--LIKMNGNDDLMELPGEIF---------------------LDQV-NL 310

Human   373 QTLDLS-------HNDIEASDCCSLQLKNLSHLQTLNLSHNEPLGLQSQAFKECPQLELLDLAFT 430
            :|||||       |.|:         .|.|.:|..|:||.|....|.|..|.....|.:|.|...
  Fly   311 KTLDLSCNAIVTLHEDV---------FKGLGNLTLLDLSKNRLTNLSSTIFAPLTSLNVLRLNKN 366

Human   431 RLHINAPQSPFQ---NLHFLQVLNLTY----------------------------------CFLD 458
            .|...:| |.||   :|::::::|..:                                  |::.
  Fly   367 SLTAMSP-SVFQDVVSLNYIEMVNTQFYGATLLMNYEAVVCTNDEACQYKSAEWQCDPRCICWVQ 430

Human   459 TSNQHLLAGLPVLRHLNLKGNHFQD-GTITKTNLLQTVGSLEVLILSSCGLLSIDQQAFHS-LGK 521
            .|...|:        ::.:|...:: ..:.:|.||.|     ||.:.:..|.|:...:.|| ...
  Fly   431 RSVGSLI--------VDCRGTSLEELPDLPRTTLLST-----VLKVGNNSLTSLPTVSEHSGYAN 482

Human   522 MSHVDLSHNSLTC----DSI-DSLSHLKGIYLNLAANSINIISPRLLPILSQQS---TINLSHNP 578
            :|.:.||.|:||.    |.: |:|:|     |::..|.|..:|...|..|.:.:   |::||.||
  Fly   483 VSGLFLSDNNLTSLGSGDQLPDNLTH-----LDVRGNQIQSLSDEFLLFLQEPNNTMTLSLSGNP 542

Human   579 LDCTCSNIHFLTWYKENLHKLEGSEETTCANP----PSLRGVKLSD---VKLSCGITAIGIFFLI 636
            :.|.|.::..|.:.:.|..::....:..|...    ..:...:|..   :.:||   .:|...::
  Fly   543 ITCGCESLSLLFFVRTNPQRVRDIADIVCTKQKKSFQQMEAFELCPSYVLLISC---VVGGLVIV 604

Human   637 VFLLLLAILLFFAVKYLLRWKYQH 660
            :.||.:..|:|  .:.|..|.|.:
  Fly   605 ICLLTVFYLMF--QQELKIWLYNN 626

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CD180NP_005573.2 leucine-rich repeat 38..57 CDD:275380
LRR 1 54..75
leucine-rich repeat 58..78 CDD:275380
LRR 2 78..99
leucine-rich repeat 79..102 CDD:275380
LRR_8 102..161 CDD:290566 12/63 (19%)
LRR 3 102..123 6/25 (24%)
leucine-rich repeat 103..126 CDD:275380 7/28 (25%)
LRR 4 126..147 3/20 (15%)
leucine-rich repeat 127..150 CDD:275380 4/22 (18%)
LRR 5 150..171 3/20 (15%)
leucine-rich repeat 151..174 CDD:275380 4/22 (18%)
LRR 6 174..195 6/20 (30%)
leucine-rich repeat 175..195 CDD:275380 6/19 (32%)
leucine-rich repeat 196..234 CDD:275380 7/40 (18%)
LRR 7 201..221 3/19 (16%)
leucine-rich repeat 235..275 CDD:275380 11/74 (15%)
LRR 8 275..296 6/31 (19%)
leucine-rich repeat 276..299 CDD:275380 6/33 (18%)
LRR 9 299..320 5/20 (25%)
leucine-rich repeat 300..322 CDD:275380 6/21 (29%)
LRR 10 322..343 4/20 (20%)
LRR_8 323..382 CDD:290566 14/65 (22%)
leucine-rich repeat 323..371 CDD:275380 6/47 (13%)
LRR_RI 327..541 CDD:238064 56/264 (21%)
LRR 11 346..366 0/19 (0%)
LRR_8 371..432 CDD:290566 22/67 (33%)
LRR 12 371..391 9/26 (35%)
leucine-rich repeat 372..397 CDD:275380 10/31 (32%)
LRR 13 397..418 8/20 (40%)
leucine-rich repeat 398..421 CDD:275380 8/22 (36%)
LRR_8 420..481 CDD:290566 14/97 (14%)
LRR 14 421..442 6/20 (30%)
leucine-rich repeat 422..446 CDD:275380 9/26 (35%)
LRR 15 446..466 4/53 (8%)
leucine-rich repeat 447..470 CDD:275380 4/56 (7%)
LRR 16 470..493 3/23 (13%)
leucine-rich repeat 471..497 CDD:275380 5/26 (19%)
LRR_8 497..555 CDD:290566 18/63 (29%)
LRR 17 497..518 4/20 (20%)
leucine-rich repeat 498..521 CDD:275380 6/23 (26%)
LRR 18 521..544 10/27 (37%)
leucine-rich repeat 522..543 CDD:275380 9/25 (36%)
LRR 19 546..564 4/17 (24%)
TPKR_C2 577..626 CDD:301599 9/55 (16%)
TehaoNP_001285901.1 leucine-rich repeat 185..207 CDD:275380 0/21 (0%)
leucine-rich repeat 209..232 CDD:275380 5/25 (20%)
leucine-rich repeat 233..261 CDD:275380 6/35 (17%)
LRR_RI <261..370 CDD:238064 36/141 (26%)
leucine-rich repeat 262..284 CDD:275380 6/21 (29%)
leucine-rich repeat 285..309 CDD:275380 6/47 (13%)
LRR_8 309..368 CDD:290566 22/67 (33%)
leucine-rich repeat 310..333 CDD:275380 10/31 (32%)
leucine-rich repeat 334..357 CDD:275380 8/22 (36%)
leucine-rich repeat 358..381 CDD:275380 8/23 (35%)
leucine-rich repeat 445..482 CDD:275380 10/41 (24%)
LRR_8 459..516 CDD:290566 19/66 (29%)
leucine-rich repeat 483..505 CDD:275380 7/21 (33%)
LRR_4 486..521 CDD:289563 12/39 (31%)
TIR 643..779 CDD:214587
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG4641
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D147327at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.