DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta7 and PBG1

DIOPT Version :9

Sequence 1:NP_649529.1 Gene:Prosbeta7 / 40639 FlyBaseID:FBgn0250746 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_176040.1 Gene:PBG1 / 842098 AraportID:AT1G56450 Length:246 Species:Arabidopsis thaliana


Alignment Length:222 Identity:89/222 - (40%)
Similarity:131/222 - (59%) Gaps:12/222 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 TMGPYGTKHSTASSTTGTSVLGIRYDSGVMLAADTLVSYGSMARYQNIERVFKVNKNILLGGSGD 105
            |:.||         .||||::.|:|..||::|:|...||||..||:|||||..:.|:.|||.||:
plant    24 TLYPY---------VTGTSIVAIKYKDGVLMASDMGGSYGSTLRYKNIERVKAIGKHSLLGASGE 79

  Fly   106 FADIQSIKRNIDQKMIEDQCCDDNIEMKPKSLASWMTRVLYNRRSRMNPLYIDVVVGGVDNEGTP 170
            .:|.|.|.|.:|:..:.|...||...:.||.:.:::|||:||||::.|||:..:|:|||.| |..
plant    80 ISDFQEILRYLDELTLNDNMWDDGNSLGPKEIHNYLTRVMYNRRNKFNPLWNTLVLGGVKN-GKS 143

  Fly   171 YLANVDLRGRSYEDYVVATGFARHLAVPLVREKKPKDRDFTAVEASELIRTCMEVLYYRDTRNIS 235
            ||..|.:.|.|:||..|||||..|||.|::|::...|..|.  :..:|:..||.||.|||...|:
plant   144 YLGMVSMIGVSFEDDHVATGFGNHLARPILRDEWHADLSFE--DGVKLLEKCMRVLLYRDRSAIN 206

  Fly   236 QYTVGVCSVNGCGVEGPFQVNENWTFA 262
            :..:...:..|..|..|:.:...|.|:
plant   207 KLQIAKITEEGVTVSQPYSLKTYWEFS 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta7NP_649529.1 proteasome_beta_type_4 60..252 CDD:239729 79/191 (41%)
PRE1 60..232 CDD:223711 76/171 (44%)
PBG1NP_176040.1 proteasome_beta_type_4 30..223 CDD:239729 83/195 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 154 1.000 Domainoid score I1347
eggNOG 1 0.900 - - E1_KOG0185
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H2090
Inparanoid 1 1.050 164 1.000 Inparanoid score I1599
OMA 1 1.010 - - QHG53720
OrthoDB 1 1.010 - - D1228942at2759
OrthoFinder 1 1.000 - - FOG0004376
OrthoInspector 1 1.000 - - oto3110
orthoMCL 1 0.900 - - OOG6_101718
Panther 1 1.100 - - LDO PTHR11599
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3101
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.840

Return to query results.
Submit another query.