DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta7 and Prosbeta1

DIOPT Version :9

Sequence 1:NP_649529.1 Gene:Prosbeta7 / 40639 FlyBaseID:FBgn0250746 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_652031.2 Gene:Prosbeta1 / 46058 FlyBaseID:FBgn0010590 Length:224 Species:Drosophila melanogaster


Alignment Length:195 Identity:38/195 - (19%)
Similarity:81/195 - (41%) Gaps:12/195 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 TTGTSVLGIRYDSGVMLAADTLVSYGSMARYQNIERVFKVNKNILLGGSGDFADIQSIKRNIDQK 119
            :|||:::.:.:|.||::.||:..|.|:....:..:::.::...:....||..||.|:|...:...
  Fly    13 STGTTIMAVEFDGGVVIGADSRTSSGAYVANRVTDKLTRITDKVYCCRSGSAADTQAIADIVAYS 77

  Fly   120 M--IEDQCCDDNIEMKPKSLASWMTRVLYNRRSRMNPLYIDVVVGGVDNEGTPYLANVDLRGRSY 182
            :  .|:|...|.:..:   .||......|:.|   ..|...::|.|.|.:....:.::.|.|...
  Fly    78 LNYHENQTNKDALVFE---AASEFRNYCYSYR---ESLLAGIIVAGWDEQRGGQVYSIPLGGMLT 136

  Fly   183 EDYVVATGFARHLAVPLVREK-KPKDRDFTAVEASELIRTCMEVLYYRDTRNISQYTVGVCSVNG 246
            .:.....|.........|||. :|   :....:....::..::...|.|..:.....:|:.:.:|
  Fly   137 RESCTIGGSGSSFIYGFVREHYRP---NMALEDCVTFVKKAVQHAIYHDGSSGGVVRIGIITKDG 198

  Fly   247  246
              Fly   199  198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta7NP_649529.1 proteasome_beta_type_4 60..252 CDD:239729 35/190 (18%)
PRE1 60..232 CDD:223711 33/174 (19%)
Prosbeta1NP_652031.2 20S_bact_beta 15..201 CDD:163402 37/193 (19%)
proteasome_beta_type_6 16..203 CDD:239731 36/192 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441183
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11599
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.