DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta7 and Prosbeta5

DIOPT Version :9

Sequence 1:NP_649529.1 Gene:Prosbeta7 / 40639 FlyBaseID:FBgn0250746 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_652014.1 Gene:Prosbeta5 / 45269 FlyBaseID:FBgn0029134 Length:282 Species:Drosophila melanogaster


Alignment Length:282 Identity:57/282 - (20%)
Similarity:110/282 - (39%) Gaps:57/282 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LNNYNSLAQPMWQNGPAPGEFYNFTGGQTPVQQLPRELTTMGPYGTKHSTASSTTGTSVLGIRYD 66
            |.|..:||.|.::|               |:..|.:........|.|   .:...||:.||.::.
  Fly    36 LANPYTLAAPPFEN---------------PLHNLNQIQANGDKTGVK---INFDHGTTTLGFKFK 82

  Fly    67 SGVMLAADTLVSYGSMARYQNIERVFKVNK---NILLGGSGD--FADIQSIKRNIDQKMIEDQCC 126
            .||:||.|:..:.||....|:::::.::|:   ..|.||:.|  :.|          :::..:|.
  Fly    83 GGVLLAVDSRATGGSYIGSQSMKKIVEINQFMLGTLAGGAADCVYWD----------RVLSKECR 137

  Fly   127 DDNIEMKPKSLASWMTRVLYN--RRSRMNPLYIDVVVGGVDNEGTPYLANVDLRGRSYEDYVVAT 189
            ...:..|.:...:..::::.|  ...:...|.:.:::.|.|..| |.|..||..|......:.:.
  Fly   138 LHELRNKERISVAAASKIMANIAHEYKGMGLSMGMMLAGYDKRG-PGLYYVDSEGSRTPGNLFSV 201

  Fly   190 GFARHLAVPLVREKKPKDR----DFTAVEASELIRTCMEVLYYRDTRNISQYTVGVCSVNGCGVE 250
            |.....|..::      |.    |....||.||.|..:....:||.     |:.|:..|.....:
  Fly   202 GSGSLYAYGVL------DSGYHWDLEDKEAQELGRRAIYHATFRDA-----YSGGIIRVYHIKED 255

  Fly   251 GPFQVNE------NWTFAETIK 266
            |...::.      ::.:.|.:|
  Fly   256 GWVNISNTDCMELHYMYQEQLK 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta7NP_649529.1 proteasome_beta_type_4 60..252 CDD:239729 42/202 (21%)
PRE1 60..232 CDD:223711 39/182 (21%)
Prosbeta5NP_652014.1 PTZ00488 38..272 CDD:185666 54/273 (20%)
proteasome_beta_type_5 74..261 CDD:239730 44/208 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440958
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11599
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.