DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta7 and Prosalpha4T1

DIOPT Version :9

Sequence 1:NP_649529.1 Gene:Prosbeta7 / 40639 FlyBaseID:FBgn0250746 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_650910.1 Gene:Prosalpha4T1 / 42457 FlyBaseID:FBgn0265606 Length:249 Species:Drosophila melanogaster


Alignment Length:245 Identity:53/245 - (21%)
Similarity:108/245 - (44%) Gaps:34/245 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 RELTTMGPYG----TKHSTASSTTGTSVLGIRYDSGVMLAADTLVSYGSMARYQNIERVFKVNKN 97
            |.||...|.|    .:::..:...|::.:|:|..:.|:|..:. .|...|...:.:.::..::::
  Fly     7 RALTIFSPDGHLLQVEYAQEAVRKGSTAVGVRGANCVVLGVEK-SSVSEMQEDRTVRKISMLDRH 70

  Fly    98 ILLGGSGDFADIQSIKRNIDQKMIEDQCCDDNIEMKPKSLASWMTRVL------YNRRSRMNPLY 156
            :.|..:|..||.:.:   |::..:|  |....:..:.:....::||.|      |.:.:...|..
  Fly    71 VALAFAGLTADARIL---INRGQVE--CQSHRLNFENQVTLEYITRYLAQLKQKYTQCNGRRPFG 130

  Fly   157 IDVVVGGVDNEGTPYLANVDLRGRSYEDYVVATG-FARHLAVPLVR---EKKPKDRDFTAVEASE 217
            |..::||:|.:|:..|.:.:..|..:|....||| :|.     .||   ||...|.:.|.  ..:
  Fly   131 ISCLIGGIDADGSARLFHTEPSGIFHEYKATATGRWAN-----TVREFFEKAYSDHEVTT--KCD 188

  Fly   218 LIRTCMEVLYYRDTRNISQYTVGVCSV-NGCGVEGPFQVNENWTFAETIK 266
            .|:..|..|.  :...:||..:.|..: ||    .|.::.::...:|.:|
  Fly   189 AIKLAMRALL--EVTQMSQMRLEVAVLENG----KPMKMLDSVVISEIVK 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta7NP_649529.1 proteasome_beta_type_4 60..252 CDD:239729 44/202 (22%)
PRE1 60..232 CDD:223711 39/181 (22%)
Prosalpha4T1NP_650910.1 PRK03996 5..239 CDD:235192 53/245 (22%)
proteasome_alpha_type_7 5..213 CDD:239724 48/220 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441096
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11599
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.