DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta7 and Prosalpha4T2

DIOPT Version :9

Sequence 1:NP_649529.1 Gene:Prosbeta7 / 40639 FlyBaseID:FBgn0250746 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_001286844.1 Gene:Prosalpha4T2 / 37910 FlyBaseID:FBgn0017556 Length:252 Species:Drosophila melanogaster


Alignment Length:228 Identity:52/228 - (22%)
Similarity:104/228 - (45%) Gaps:30/228 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 QQLPRELTTMGPYG----TKHSTASSTTGTSVLGIRYDSGVMLAADTLVSYGSMARYQNIERVFK 93
            |:..|.:|...|.|    .:::..:...|::|:|:|.::.:::..:.. |.|.:...:.:.::..
  Fly     3 QRYDRAVTIYSPDGHLLQVEYAQEAVRRGSTVMGLRTNNAIVIGVEKR-SVGDLQEERMVRKICM 66

  Fly    94 VNKNILLGGSGDFADIQSIKRNIDQKMIEDQCCDDNIEMKPKSLASWMTRVL------YNRRSRM 152
            ::.::::..||..||.:.:   :.:..:|.|....|.| ||.:: .::||.:      |.:.:..
  Fly    67 LDDHVVMTFSGLTADARIL---VSRAQMEAQSHRLNFE-KPTTV-EYITRYIAQLKQNYTQSNGR 126

  Fly   153 NPLYIDVVVGGVDNEGTPYLANVDLRGRSYEDYVVATGFARHLAVPLVREKKPKDRDFTAVEASE 217
            .|..:..:|||.|.:|||:|...|..|..||.....||          |..:|. ||:....|.|
  Fly   127 RPFGLSCLVGGFDEDGTPHLFQTDPSGIFYEWRANTTG----------RSSQPV-RDYMEKHADE 180

  Fly   218 LIRTCMEVLYYRDTRNISQYTVGVCSVNGCGVE 250
            ::....|.   ...::|.:..|.|.|:|...:|
  Fly   181 ILTIADEA---AAIKHIVRTLVSVSSLNHTQME 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta7NP_649529.1 proteasome_beta_type_4 60..252 CDD:239729 46/197 (23%)
PRE1 60..232 CDD:223711 40/177 (23%)
Prosalpha4T2NP_001286844.1 arc_protsome_A 5..215 CDD:163366 51/226 (23%)
Ntn_hydrolase 5..214 CDD:294319 51/226 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441094
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11599
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.