DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta7 and Prosalpha7

DIOPT Version :9

Sequence 1:NP_649529.1 Gene:Prosbeta7 / 40639 FlyBaseID:FBgn0250746 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_724834.1 Gene:Prosalpha7 / 36018 FlyBaseID:FBgn0023175 Length:253 Species:Drosophila melanogaster


Alignment Length:187 Identity:46/187 - (24%)
Similarity:81/187 - (43%) Gaps:25/187 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 STASSTTGTSVLGIRYDSGVMLAADTLVSYGSMARYQNIERVFKVNKNILLGGSGDFAD---IQS 111
            |.|...:|| |:|||....|:||.:.::: ..:.......|:|.:.|||.:..:|..||   :..
  Fly    28 SKAVEKSGT-VIGIRGKDAVVLAVEKIIT-SKLYEPDAGGRIFTIEKNIGMAVAGLVADGNFVAD 90

  Fly   112 IKR----NIDQKMIEDQCCDDNIEMKP--KSLASWMTRVLYNRRSRMNPLYIDVVVGGVDNEGTP 170
            |.|    |..|:.      :..|.:|.  ..:|.::.  .|...|.:.|..:.:::...|....|
  Fly    91 IARQEAANYRQQF------EQAIPLKHLCHRVAGYVH--AYTLYSAVRPFGLSIILASWDEVEGP 147

  Fly   171 YLANVDLRGRSYEDYVVATGFARHLAVPLVREKKPKDRDFTAVEASELIRTCMEVLY 227
            .|..::..|.|:..:..|:|.|:.|| ....||...|     :...||:.:..|::|
  Fly   148 QLYKIEPSGSSFGYFACASGKAKQLA-KTEMEKLKMD-----MRTDELVESAGEIIY 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta7NP_649529.1 proteasome_beta_type_4 60..252 CDD:239729 42/177 (24%)
PRE1 60..232 CDD:223711 42/177 (24%)
Prosalpha7NP_724834.1 proteasome_alpha_type_3 5..216 CDD:239720 46/187 (25%)
PRE1 6..231 CDD:223711 46/187 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441011
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11599
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.