DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta7 and Prosbeta4

DIOPT Version :9

Sequence 1:NP_649529.1 Gene:Prosbeta7 / 40639 FlyBaseID:FBgn0250746 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_001260511.1 Gene:Prosbeta4 / 34999 FlyBaseID:FBgn0032596 Length:201 Species:Drosophila melanogaster


Alignment Length:202 Identity:46/202 - (22%)
Similarity:84/202 - (41%) Gaps:31/202 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 SVLGIRYDSGVMLAADTLVSYGSMARYQNIERVFKVNKNILLGGSGDFADIQS----IKRNID-Q 118
            ::|||:....|||||||..:...:...::..::.||:.::|:...|:..|.:.    |.:||. .
  Fly     3 TLLGIKGPDFVMLAADTTHARSIIVMKEDQNKIHKVSDSLLISTVGESGDTEQFTEFISKNIALY 67

  Fly   119 KMIEDQCCDDNIEMKPKSLASWMTRVLYNRRSRMNPLYIDVVVGGVDNEGTP------YLAN--- 174
            ||      .:..::.|:..|.:..:.|........|..:.:.|.|.|....|      ||||   
  Fly    68 KM------RNGYDLSPRESAHFTRKNLAEYLRSRTPYQVFMFVAGYDPNAGPELTFIDYLANALP 126

  Fly   175 VDLRGRSYEDYVVATGFARHLAVPLVREKKPKDRDFTAVEASELIRTCMEVLYYRDTRNISQYTV 239
            |:..|..|.....::.:.|:.           ..:.|..||.::.:.|:..:..|...|:..:||
  Fly   127 VNYAGHGYGAIFASSIYDRYW-----------HPNITQAEAYDVFKKCIAEIQKRLVVNLKNFTV 180

  Fly   240 GVCSVNG 246
            .|...:|
  Fly   181 AVVDKDG 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta7NP_649529.1 proteasome_beta_type_4 60..252 CDD:239729 46/201 (23%)
PRE1 60..232 CDD:223711 41/185 (22%)
Prosbeta4NP_001260511.1 PRE1 1..194 CDD:223711 46/202 (23%)
proteasome_beta_type_2 1..192 CDD:239727 46/202 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441129
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11599
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.