DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta7 and Prosalpha6T

DIOPT Version :9

Sequence 1:NP_649529.1 Gene:Prosbeta7 / 40639 FlyBaseID:FBgn0250746 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_609623.1 Gene:Prosalpha6T / 34726 FlyBaseID:FBgn0032492 Length:289 Species:Drosophila melanogaster


Alignment Length:262 Identity:57/262 - (21%)
Similarity:102/262 - (38%) Gaps:59/262 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 QLPRELTTMGPYG----TKHSTASSTTGTSVLGIRYDSGVMLAA------DTLVSYGSMARYQNI 88
            |...:.||..|.|    .:::..:...|.:.:|::.....:|||      ||    .::.|    
  Fly     5 QYDNDTTTWSPQGRLFQVEYAMEAVKQGAATVGLKGTDYAVLAALCRTSKDT----NTLQR---- 61

  Fly    89 ERVFKVNKNILLGGSGDFADIQSIKRNIDQKMIEDQCC----DDNIEMKPKSLASWM------TR 143
             ::..|:.::.:..:|..||    .|.:.|.| ..:|.    ..|.|...:.|.|.:      |.
  Fly    62 -KIMPVDDHVGMSIAGLTAD----ARVVCQYM-RTECMAYRHSYNAEFPVRRLVSNLGNKLQTTT 120

  Fly   144 VLYNRRSRMNPLYIDVVVGGVDNEGTPYLANVDLRGRSYEDYVVATGFARHLAVPLVREKKPKDR 208
            ..|:||    |..:.::|.|.|.:| |::..|...........:|.| :|..:.....|:..:  
  Fly   121 QRYDRR----PYGVGLLVAGYDEQG-PHIYQVMPTANVLNCKAMAIG-SRSQSARTYLERNME-- 177

  Fly   209 DFTAVEASELIRTCMEVLYYR------DTRNISQYTVGVCSVNGCGVEGPFQV---NENWTFAET 264
            .|...:..|||  |..:...|      |..|:   |:.|..|   |.:.||::   .||..:.:.
  Fly   178 SFEDCDMDELI--CHAIQAIRGSLGSDDVENL---TINVAIV---GKDVPFKMFTEAENQKYVKL 234

  Fly   265 IK 266
            :|
  Fly   235 VK 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta7NP_649529.1 proteasome_beta_type_4 60..252 CDD:239729 46/213 (22%)
PRE1 60..232 CDD:223711 41/193 (21%)
Prosalpha6TNP_609623.1 PRE1 4..233 CDD:223711 56/257 (22%)
proteasome_alpha_type_1 6..215 CDD:239718 50/238 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441159
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11599
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.